KEGG   Ciona intestinalis (sea squirt): 100186631
Entry
100186631         CDS       T01056                                 

Name
(RefSeq) multiple PDZ domain protein isoform X1
  KO
K06095  multiple PDZ domain protein
Organism
cin  Ciona intestinalis (sea squirt)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 Peptidase_M50 L27_2 Tricorn_PDZ
Other DBs
NCBI-GeneID: 100186631
NCBI-ProteinID: XP_018667521
Position
5:complement(3700137..3728893)
AA seq 2061 aa
MPSQEELEKAALIIKRIQNQLKRQGDYSNDAELEAMKSLMESPLFKKMAQLQASIQQLKK
EVKKDDFDINNVEFSHENGGLVVDGKEVENDSSMFNGRNGDLEEFIKSAAQGRETEMIEI
FKSENEGLGFSVVGLKSEHRGDLGIFVQDIRSGGVADRDGRLKESDQILVINNQPLTQTI
SHQQAIGILQKVKGTVKLVVARGGIPQSQGHLSAEGSQVSRSSSILSSLSQASGMPPDTK
WTDVETIDLRNDGRGLGFGIVGGRSTGGVVVKTIVPGGAAHEDGRLKSGDHILRIGEEDL
MNMGSEEVAQVLRQCGAHVRLIVARGPVDDDDDVNDDLQDDKQDAGERGSVSSEDDSHSS
YSSSSQEENSLPADAQIFDVELVKDAKGLGITIAGFLPEDQNRNGTPGIYVKGVSSGSAA
DIDGRIRPGDKLIAVDGKRLDGDDVSSDQAVEVLRSTGVVVRLTLARTTNRNETQNKSQP
VSRQIVNERLQQEKEFGQELSPDEEERIKQKWRVVMGPQCDIVIAQLKKYNYLSGLGISL
EGTVDENEMPHHYIRSILPEGPVGQSNKLEAGDELLEVNGNHLLGLSHVEVVVILKELPL
TVRMVCARPKEHWTRDPARDSVVFEEKDGDFLEMKMPPINDPMNIIPPAHENVDDDTSSD
SSLSQDSISQIQMHLPEMPPMQNQVYESELPTPVNQFHPQSSVSDSDETDVETSPKNEQE
QLNSAWEDEVTVIELEKGDRGLGFSILDFQDPLHEDKTAVLVRSLVDGGIAEQDGRLEPG
DRLIFVNDKSLQFADLDQAVRVLKAVPQGRVLIGVTKPRPMFRVPPSSDSEDAVEEEEVR
TPVLPRPPSVRSSSSSSSSTSQEMQHYPMPSDSQYSASPVEMEVKLPGPPPPPPHIEPNP
PTPEYEPPTPRYEPPTPRYEPPAHHFEPPQPQIVSEPLQQSYEPPIQRYEPPQPQTPPES
PPAAPHVIRTQSGKYTVKDYNRPARLSSSETNPVTTANQKVEVKQVQMSGMTAIAVTANT
IQRKEEPQQPIIRQQEVFSSAPVVPPKPVGYTAPSWQTAEPEKPKPKPPIDGFERIVQMS
KGKSSLGITVSPDKEGDGLIVRSVITGGAVARAGEPNIGDMIRRVNNDSATGLGAAQARS
LIRNHSAYSADVKIAYIPKKYIEAFKLGLPVPEDSDVDEDRRTPKTPSRVDHFAALKSVF
EMQNGQQPQDASKFYLDSSLWGSTKRVDIRREAGQSLGISIVGGKNINANSQQQISLDNG
DLIDGIFIKEIIEGSPVDVNGEMKPGDKILKVDGVDLSNATHEGAVEAILKAGVHVVFHV
QTFVGHPKQIILNSKSCTHFTGGKLMEPPPPQPEEESEIVKAERKYGHLPGEIHVVEMVK
GPAGVGLSLAGNKDRSQQQIFVVGVNPNGAAGKDGRVKVGDQLLEINHVPLNQRNNHELA
SNVIKNAKSKLLFVINRQQKEARADKPLKKTPSVESSSHRRQSSDVPAEKSPPPPKRSSS
GGRHSPFSDVRVIKLVKDFQGLGFAISETPTGIVVQSIAPGGTADRDGRLVRGDHILAVD
DQSVSGVSYETAISILKQSRGTVKLTVASGPVKSSASSDASSVTSSGHRLSTMSPTLDSG
SENSDPLTCPIIPGRETTIEINKGKAGLGVSIVGGSDSLLDAVLVHTVYEQGAAAKDGRL
WPGDRILTVNNHSLRHATHDEAIEVLRNTPGKVHLTILRDENRETINNESESDIYDIYDV
NLMKKSGRGLGLSIVGRKNAAGVFVSDLVQGGAAARDGTMKPGDQILSVNGVNIRMAGQE
VAAQLLKNAQGKVDLRIGRLKSGAPSDLIKMPKLSLSSNASEDAPKSPTDDLGGDIRFVE
IDKTPTQPLGISIAGGVGSPLGDVPIFVAVVQNHGAAAGKLKVGDRIRSINGQTTDNKSH
DEVVAMLKGQDDAIVLMQVQEGGESIKQLSEYLVQSAKPNLPISGQQGSQEKKEIDIELN
RGSDGLGFSIVGGHGSPHGDLPIYVKSVFSVGAAAVDGRLRRGDRIVSVNGEKLDGYTHE
EAAEALKRRATRIILRVVPST
NT seq 6186 nt   +upstreamnt  +downstreamnt
atgccgtcgcaagaagagcttgaaaaagcagctttgattattaaacggattcaaaaccag
ttaaaaaggcaaggtgattattccaatgatgctgaactagaagctatgaagtcactaatg
gagagtccgctgtttaagaagatggcacaacttcaagcttcaatacaacaacttaaaaaa
gaggtaaaaaaagatgacttcgacatcaacaatgttgagttttcacacgaaaatggtggg
ttggtggttgatggtaaagaggtggaaaacgatagttcaatgtttaatggtagaaatgga
gatttggaagaatttattaaatctgctgcgcaaggaagggagacggaaatgattgaaata
tttaaatcggagaacgaaggacttgggtttagtgtggttgggttgaagtcagaacacagg
ggtgaccttggaatatttgtacaggacatcaggtctggtggagtggctgacagggatggt
aggttgaaggaaagtgatcaaatacttgtcataaacaaccaaccactcacgcaaaccata
tcgcatcagcaagcaattggaatcttgcagaaagtgaaagggaccgtcaaacttgtggta
gcacgaggggggattccccaatcacaaggccacttatcagcggaggggtcacaggtgtca
aggtcatcatctattctaagctctctatcccaagcctcaggcatgcctccggacacaaaa
tggaccgatgtggagacgattgatcttcgcaatgatggaagaggacttggattcgggatc
gttggaggaagatcaactggaggagtggtggtgaagactattgttcctggaggagcagct
catgaggatgggaggttgaagtccggggatcacattctcaggatcggggaggaggacctg
atgaacatggggtccgaggaggtggcacaggttctaaggcagtgtggagctcatgttaga
ctgattgtggctcgaggccctgttgatgatgatgatgatgtaaatgatgatcttcaggat
gataaacaagatgcaggagaaagaggatctgtatcttctgaggatgactcacattcttcc
tattcaagtagcagccaagaagaaaattccctcccagctgatgctcaaatatttgatgta
gaactagtgaaggatgccaagggtcttggaattactattgctggcttccttccagaagac
caaaatcgcaatggtacacctggtatatatgtaaagggggtatcatctggttctgcagct
gatattgatggtaggattcgtcctggggacaaactgatcgctgttgatggtaaaagattg
gatggagatgatgtatcaagcgatcaagctgtggaagttttacgatcaactggtgtggtt
gtacgactcactcttgcaaggactactaacagaaacgaaactcaaaataagtcacaacct
gtatcccgacaaattgtgaatgaaagacttcagcaagaaaaagagtttggtcaagagttg
agtcctgatgaagaagaaaggatcaaacagaagtggagggtggtgatgggacctcagtgt
gatattgtgattgctcaactaaagaaatacaattacctgagtggactcggtataagtttg
gagggcacagtggatgagaatgaaatgccacatcattatataaggtccattcttcctgaa
gggccagttgggcagagcaacaagcttgaagctggtgacgaacttcttgaagtaaacggc
aaccatttacttggtttaagccacgtagaagtggttgtcatcctcaaggagcttcctctt
acagtccgtatggtgtgtgcgagacctaaggagcattggacacgagatcctgcgagggat
tcagtcgttttcgaggagaaagatggagattttttggagatgaaaatgccgccaataaac
gacccgatgaatataattcctcctgctcatgaaaatgtagatgatgatacatcatctgac
tcatcattatcacaggattctatctcacaaatccagatgcacttgcctgagatgccacca
atgcagaaccaagtatatgaatcagagttaccgaccccagtcaaccagttccatccacaa
agtagtgttagtgacagcgatgaaacagatgtggaaacttccccaaaaaatgagcaagaa
cagttaaacagtgcttgggaagatgaagtcactgttattgaacttgagaagggtgatcgg
ggtctggggtttagtatcctggattttcaggacccgttacatgaagacaaaacagcagtc
cttgttcggtctttagtggatgggggtattgcggaacaagatggccgacttgaacctggt
gatcgacttatattcgttaacgataaatcgcttcagtttgccgaccttgaccaggctgtc
cgtgttttaaaggctgtaccacaaggtcgtgtattgattggagtaactaaaccacgtcca
atgttcagagttccaccaagttctgacagtgaagatgcagtagaagaagaggaagtaaga
acacccgttcttccacgacctccatcagtcagatcgtcttcctcttcatcatcttccaca
tcgcaggaaatgcagcattaccccatgccctctgactcccagtattctgcctcacccgtt
gaaatggaagtcaaactaccgggacctccaccccctccaccccatattgaacccaaccct
ccaaccccagaatacgaacccccaacaccccgctacgagcccccaacgcctcgttacgag
cccccagcacaccattttgagcctccgcagccccaaattgtttccgaacccctacaacaa
tcttacgaacccccaatccagcgttacgagcccccgcagccccaaacaccccctgaaagc
ccacctgctgccccccatgttatccgcactcagtcaggcaaatacacagttaaagattac
aacagacctgcgcgtttgtcttcatcagaaaccaaccctgtcaccactgccaatcaaaag
gttgaagtgaagcaagtccagatgtcaggcatgacagctatagcagtgacagcaaacaca
atacaacgcaaggaagaacctcaacaacctattatcaggcagcaagaggtgttctcatct
gctccagtggtccccccaaaaccagtgggttatactgccccctcatggcagacagctgaa
cctgagaaaccgaaaccaaaacctccgatcgacgggtttgaacgaattgttcaaatgtca
aaaggaaaatcaagtttaggtattactgtctcacctgacaaggaaggcgacggtttaatt
gttcgttccgttatcactggaggcgctgttgcacgggcaggggagccaaacataggggac
atgattcggcgtgttaataacgactcagctacgggattaggggccgctcaagcacgctcg
ctaatccggaaccattcagcttacagcgcagatgtcaagatcgcctacatccctaaaaaa
tacattgaggcattcaaacttggacttcctgttccggaggactcagatgttgatgaagat
cgtcggacaccgaaaactccatcaagagttgatcattttgcagcacttaaatctgtattt
gaaatgcaaaatggacagcaacctcaggacgcttcaaagttttatcttgattccagtttg
tggggttctacaaagagagttgacatacgtagagaagcaggtcaatcacttggcatcagt
attgttggcgggaaaaatatcaatgcaaactcacagcaacaaatatcactggataatggg
gaccttattgatggaatcttcatcaaagaaataatagaaggaagtccagtagatgtgaat
ggtgaaatgaaaccgggcgacaaaattttaaaagttgatggggttgatttgagtaacgca
acacacgagggagcagtggaggcaatattaaaagcgggcgtgcacgttgtctttcatgtt
caaacgtttgtcgggcatccaaaacagataatccttaacagcaaaagctgtactcacttt
actggtggaaaactcatggaacctcccccaccccagccagaagaagagtcagaaattgtg
aaagcagagcggaaatatggacatttacccggagaaattcacgtcgtggaaatggtgaaa
ggccctgctggtgttggattaagcttagctgggaataaagacaggtcccaacaacagata
tttgtggttggggttaaccccaatggagcagcgggtaaagatgggcgtgtcaaagtgggc
gaccaactactggagatcaaccacgttcctttgaaccaacgtaacaaccacgaacttgcg
tcgaatgtgatcaagaatgcaaaatcgaaacttctatttgtgatcaatagacagcagaag
gaagcacgagctgataaacctctaaagaaaactccttcagtagaatcctcatcccatagg
aggcagagctctgatgtccccgctgagaaatctcctcctcctcccaaacgctccagctct
ggaggacgacatagcccattttctgacgtcagagttatcaagctcgtaaaggatttccaa
ggattaggctttgcgatctctgaaacccctactggtatagtggttcaatccattgcacca
ggtggtacagcagatagagatggtagattggtaagaggagatcatatacttgctgtggat
gatcagtctgttagtggagtctcttatgaaacggcgatctccatattaaagcagtcaagg
ggaacagttaaacttactgtggcatctggtccagtcaagtcttctgcttcatcagatgcc
tcttctgttacatcctccggacacagattatccacgatgtccccgaccctggatagcggg
agtgagaactctgacccacttacgtgcccgattattccaggcagggaaacaaccatagaa
atcaacaaagggaaggctggacttggagtgagcattgtgggaggatctgacagtttgttg
gatgcagtgttggtgcacacagtgtatgaacaaggagctgctgcaaaagacggaaggtta
tggccaggtgacaggatcttaacagtgaacaatcacagtttgcgtcatgccacacatgac
gaggcaatcgaagtattgcgcaacaccccggggaaggtccaccttactatcctacgtgat
gaaaacagggagacaattaacaatgaatcagagtccgatatatatgatatctatgatgta
aatttaatgaagaaaagtgggcgaggtctcggacttagcattgttggaagaaaaaacgca
gctggtgtgtttgtgagtgaccttgtacagggtggtgcagcagcaagagatggaacaatg
aaacctggagatcaaatactaagtgttaatggcgtcaatataaggatggctggacaagaa
gtagctgcacaattgctgaagaatgctcagggcaaagtcgatctcaggatcggaagatta
aagtccggagctccttctgatctcataaagatgccaaagctaagtctcagttccaatgca
tctgaagatgctcctaagagtcccactgatgatttgggaggagacatccgattcgtggag
atcgataagacccccacccaaccacttggcatcagtatagcaggtggagttggttctcct
ttaggggatgttcccatttttgtagcagttgttcaaaaccatggggcagcggcaggaaag
ttgaaggttggggacagaatacgaagcattaatggacagactacagataacaagtcacat
gatgaagtggtagcaatgctgaagggtcaggatgacgctattgttctaatgcaggtgcaa
gaaggtggggaaagtataaaacaactaagtgaatatcttgtacaatctgccaaacctaat
ttaccaatcagtggacaacaaggaagccaagaaaagaaggaaatagacatcgagttgaac
cgggggtctgatggacttggttttagtatcgttggagggcatggatcaccacatggggat
cttcctatttatgtgaagtctgtgttctcagttggagcagcagcagtggatgggaggtta
cgtaggggggatcggattgtatccgtgaacggcgagaaattggacggttatacgcatgag
gaagcggccgaggctctcaaacgaagagcaacccgtatcatacttcgtgtagttccgtcc
acataa

DBGET integrated database retrieval system