KEGG   Ciona intestinalis (sea squirt): 100186654Help
Entry
100186654         CDS       T01056                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00071  Fatty acid degradation
cin01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cin00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100186654
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cin03029]
    100186654
Enzymes [BR:cin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     100186654
Mitochondrial biogenesis [BR:cin03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100186654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 100186654
NCBI-ProteinID: XP_002121679
Ensembl: ENSCING00000003785
UniProt: A0A1W2W6L3
Position
7
AA seq 716 aa AA seqDB search
MANQTWNIIMGFVIPIVLGVMTMSIIPGLSGVNDKLIRTLVGGGVVVGFYFLFKFLKWEL
IRKLLEYREWMYDHHSFKTKAWGILLKLLIPKNVKLFQLEKYLPKYPLPKLDDTCDKTLT
MVKPLLSDEEFKKVSETMEDFRKNEGPKLQKVLEKRYDETENWLAELWNKYLYLGSRGPL
PVHSNYCCLGDRAFQYNDPGSNQLSQMANCIYYFMEYMGKINNGSLAGMMIQNIVPICCD
RYRYLCATTRIPGETIDELKRFPNSTHVIIFRKGLMYKLDLKVLDSEGKRTFLTPTEIQG
QLKVIMEDADLMGSKVEGEIQNPSIFTTTERTRWARIRNRMLVNRTNMESLNIVESSAFC
FVLSEDTPQNHSEEFASYLTGNGFDRWFDKSFTFIVNKNGAMGFNVEHSTSEATLGGRMW
EYTLFHCKYNVHGDPVDPRPPTHPTLHDPRQLKWDLTEFKDEIADIKTEWDKLANNVDAC
VYYMNKGKGIAKKMKLSPDGFLQMALQLAFYRERKITPKTYETAATRLFKYGRTETIRPV
SEHSVAFTKCFDDPSVPDSVKIKHLKSAIKHQTTYKFDATNGRAVDRHLLGLYFAGKFTG
NVPELFKLKPFYESDLLSTSQSPLRYDPVIGKISTTDPIGGGFGAQRVDGYGVSYFMLEN
KVHFLITSFKSCSETNSLKFGQNIERAVNDLQVLLAGGNQQKSNKETNGSVGKGDK
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatcaaacatggaacatcataatgggctttgttattcctattgttctcggagtt
atgacaatgtcgattatcccggggttaagtggggtgaacgacaaacttatccgcacactg
gttggtgggggggtggtcgttgggttttatttcctgtttaaattcttgaagtgggagttg
ataaggaagttgcttgaatacagggaatggatgtacgaccatcacagttttaaaactaag
gcatgggggattctattaaagctgttaatcccgaagaacgtaaagctgttccaactcgaa
aaatacctccctaaatatcccttgccaaaactggatgacacatgtgacaaaaccctgacg
atggttaaaccgttgcttagcgacgaagagttcaagaaagtttccgaaacaatggaagac
ttccggaaaaacgaaggtccaaagctacagaaagttttggaaaagcgatacgacgagacg
gagaattggctggctgaactttggaataaatatctttaccttggaagcaggggaccttta
cctgtccattccaactattgctgcctcggtgatcgagcgttccaatacaacgacccgggg
tccaaccaactcagccagatggccaactgtatttattacttcatggagtacatggggaag
attaataatggatcgctagcaggcatgatgatacagaacatcgtccccatatgttgcgat
cgatatcgatacttgtgcgctacaactcgtatacccggtgaaaccatcgatgaattgaaa
aggtttccaaactccacacatgtcatcatattcagaaaaggtctgatgtacaaacttgac
ctcaaagttttggattccgaggggaaacgaacttttttgaccccgaccgagatccagggt
caacttaaggtcataatggaggatgctgacctcatggggtcaaaggtcgaaggtgaaatt
caaaacccgtcaatttttacgacaacggagagaactcggtgggccaggattcgcaacaga
atgttggtgaaccgaaccaatatggaaagtttaaacatcgtagaaagttccgcgttttgt
tttgtgctcagtgaagataccccacagaaccacagcgaggagttcgcgtcttacctcacc
ggcaacggatttgaccgctggttcgacaaatcgtttacttttattgtgaataagaacggg
gcgatgggattcaacgtggaacattcaacttcggaagctactctcggcggacgcatgtgg
gagtacacgttgtttcattgtaaatataatgtccatggtgaccccgttgacccccgaccc
cccacccatcccaccctccatgaccctcgtcaacttaaatgggatctcaccgagttcaaa
gatgaaatcgcggacattaaaactgaatgggataaactggcaaacaacgtcgacgcatgt
gtctactacatgaacaaaggaaaaggaatcgcaaagaaaatgaaattaagtcccgatggt
ttcctacagatggcgctacaactagcgttttatcgggaacggaaaattacgccgaaaact
tacgaaactgcggctacaagattatttaaatacggtcgaactgagacaatacgtccggtg
tctgaacattcggtcgctttcactaagtgttttgacgacccctctgtccctgactctgtg
aagatcaaacacttaaaatctgcgataaaacatcagaccacgtacaagtttgacgcaact
aacggtagagctgtagatcgccacctactgggactttacttcgctggaaagtttacaggg
aatgtgccggagttgtttaaacttaagccgttctacgagtccgaccttctctccacctcc
caatcacccctacgatacgaccccgttatcgggaagatttcgacaacggaccccataggg
ggcggatttggggcacaacgagtggacgggtacggggtgtcttacttcatgctagaaaat
aaagttcatttcttgattacaagcttcaaaagttgttcggaaacaaactcgttgaaattt
gggcaaaacattgaacgggccgttaatgacctccaggtgttgttggcgggaggaaatcaa
cagaaatccaacaaagaaacaaatgggagtgtggggaaaggagacaagtga

DBGET integrated database retrieval system