KEGG   Ciona intestinalis (sea squirt): 100186673Help
Entry
100186673         CDS       T01056                                 

Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 1 isoform X1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00071  Fatty acid degradation
cin00410  beta-Alanine metabolism
cin00592  alpha-Linolenic acid metabolism
cin00640  Propanoate metabolism
cin01040  Biosynthesis of unsaturated fatty acids
cin01100  Metabolic pathways
cin01200  Carbon metabolism
cin01212  Fatty acid metabolism
cin04146  Peroxisome
Module
cin_M00087  beta-Oxidation
cin_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:cin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    100186673
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100186673
   00592 alpha-Linolenic acid metabolism
    100186673
   01040 Biosynthesis of unsaturated fatty acids
    100186673
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100186673
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100186673
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     100186673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 100186673
NCBI-ProteinID: XP_002119567
Ensembl: ENSCING00000001357
UniProt: A0A1W2W5V3
Position
Unknown
AA seq 652 aa AA seqDB search
MSERINPDLQKERDAATFDVEELSVLLHNGAHELEKKRKLEELVRNDPDYKSLPFDFLSR
EAQYEEGVRRSTIAVAKKDQLGSLIENHGDLITYNTHVGRGKAGPFNLHTGMFIPTLVKQ
GSPEQVAKWLPLSENYQIVGTYAQTEMGHGTFLRGLETTAHYDPHTQEFVLNSPTTTSIK
WWPGALGKTSTHAVVLAQLYTLGKCHGIHAFVVQLRSLEDHKSLPGIMVGDIGPKFGYGA
NDNGFLKLSNHRIPRENMLMKYSKVAPDGSYSKPPKSTLTYGTMTFVRAMIVRGSAQAIA
QGATIAIRYSAVRRQSEMRPGEPEPQVLSYPTQQYKLFPLLCAAYAFHFVQVKMIEAYSE
VTELVNKGDFSRTQELHALSSGLKAYTSAISNTGLEVCRTSCGGHGYSCASGFPALYTNF
TPSVTYEGENTVLLLQCARYLVKCTRDLRSGAKLPGSVAYLSCGCDPSSIGKDFTNVKTL
DSLYKQRALGLIRFASGKVDASMDGGMDLVGALNESSVHLVRAAVAHSHYFVVRNFFEKL
SKLTSTSQLLMEVLHQLSLFYALDGVAQHSGEFLEDGLLSGEDVKQIRQLTVEMLPKIRV
NAVALVDAFEFGDDVLGSVLGRYDGNVYENLFKWAQDSPLNKTDVSVWFGNS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaggataaacccagaccttcagaaagaaagagacgcagcaacttttgacgtt
gaagaattgtcggttcttttgcacaatggagcacatgaacttgagaagaaacgtaaactt
gaggaattagtgaggaacgacccagattataaaagtcttccgtttgacttcctgtcacgt
gaagctcagtatgaggaaggtgtccgtcggagcacgatcgctgtagcgaagaaagatcaa
cttggttcgttgatcgaaaaccatggagatcttataacttacaacactcatgtgggaagg
ggtaaagcgggcccattcaacctacacacaggcatgttcatccctaccctggtgaaacaa
ggttcaccggaacaagttgccaagtggttgccactcagtgagaattatcagatagttgga
acctacgcacaaactgagatgggacacggaacctttctgcgtgggttggaaacaacggcc
cattacgacccgcacacccaggagtttgttctcaattcaccgacaacgacgtctatcaaa
tggtggccgggggcattgggcaaaacctccacgcacgctgttgttctcgcacagttatat
acgttgggtaaatgccatggaattcatgcgttcgtcgttcaactcagaagtttggaggat
cataagtctctaccaggaataatggttggggatattgggccaaagttcgggtacggcgca
aacgataacggtttcctgaagttgagcaaccacagaataccgagggagaatatgctcatg
aaatattcaaaggttgcgcccgatggttcgtacagcaaaccccccaagtccacattaaca
tatgggacgatgacattcgtacgtgccatgatagtacgagggtccgcacaagccatcgca
cagggggcgaccatcgcaatacgatacagcgctgtgaggaggcagagtgagatgcggcct
ggcgaaccagagccccaggtcctaagttaccccacacagcagtacaagttgttcccacta
ctttgcgcggcttatgctttccactttgtgcaagtgaagatgattgaggcctacagtgaa
gtgacggaacttgttaacaagggggatttctcaagaacgcaagagcttcatgctttatca
tctggtttgaaagcttatacatcagcgatatcaaacactggtttggaagtatgtcgcact
tcatgtggtgggcatggttactcttgtgcgagcggtttccccgctttatacacaaacttc
acgccatccgtaacttatgaaggagaaaacacagtgttgttgctacaatgcgcaaggtac
ttggtgaaatgcacccgtgacttgcgtagcggggcaaaactaccgggcagtgttgcatat
ctatcgtgtggttgtgatccatcaagtatagggaaggacttcaccaacgtcaagacgctc
gattctctttataaacaacgagcgctgggattaatcaggtttgcgagtggcaaagtagac
gcttcaatggacggtggaatggacctcgttggtgcgttgaatgaatcgtccgtacacctt
gtgcgggctgcagttgcccacagccattactttgttgttcggaacttcttcgagaaatta
tcaaagttgacttcgacctcccaactcctcatggaggttctacaccagttgtcgttgttc
tacgcgcttgacggggtcgctcagcatagtggggagtttcttgaggatggtttattgagt
ggggaagatgtgaaacagatacgacaactaacagtggaaatgctgccgaagattcgtgtc
aatgctgtggctctggtggatgcattcgagtttggtgatgatgtccttggttcagtgttg
ggaagatacgatggtaacgtttacgagaatctttttaaatgggctcaggattcaccactt
aataaaacggatgtaagtgtttggtttggtaattcttaa

DBGET integrated database retrieval system