KEGG   Ciona intestinalis (sea squirt): 100186858Help
Entry
100186858         CDS       T01056                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 2 isoform X1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00260  Glycine, serine and threonine metabolism
cin01100  Metabolic pathways
cin01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cin00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100186858
Enzymes [BR:cin01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     100186858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 100186858
NCBI-ProteinID: XP_026695261
UniProt: A0A3Q0K3P1
Position
Unknown
AA seq 365 aa AA seqDB search
MEVVTVDLRSDTLSLPTADMRCAMAEAELGDDVYGEDPTVNRLQMLAAELFGKEDALFVP
TGTMGNLISVMCHCWQRGSEVLLGDQSHIHRFEQGGIAQLAGVHPKTIRNLPDGTFQLSE
LQAKYQTSADVHFASTSLICVENPIEGKVLPLNFMVQLRSVADELKLPIHLDGARVINAA
IALGVPPKLITKYADTANICLSKGLCAPVGSVIVGSKQFITKAKRVRKLLGGGMRQAGVL
AAAGIISLNVISKKLHLDHDNAKHFAQTILSLAPDLVEVNLKHVTTNIAMFQLKNAMPTK
NGRTVAQEFVWRMENTSDGSKTRVKMCAFGDVTVRAVFYHQISKLDVQKALEKFELVASA
WRNEL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggaagtggtaacggtcgatttaaggagtgatacattatctcttcctacagctgatatg
cgttgtgcaatggctgaagcagaacttggtgatgatgtttatggtgaagacccaaccgta
aatcgattacaaatgttggctgctgaattgtttggaaaggaagatgcattgtttgttcca
acaggaacaatgggaaatttgatatcagtgatgtgccattgttggcaacgtggatcagaa
gttttactgggcgatcaatctcatattcatcggtttgagcaaggtggaatagctcagttg
gcaggagtccacccaaaaacgatacgcaatttacctgatggtacttttcaattaagtgaa
ctgcaagctaagtatcaaacaagtgctgatgtacattttgcatcaacttcactcatttgc
gttgaaaacccgattgaaggaaaagttcttcctttgaattttatggttcagttaagaagt
gttgcagatgaattgaagctacctatccatttagatggagccagggttataaatgctgca
atagcattaggtgttcctccgaaattgataacgaagtatgcagacactgcaaatatttgt
ttgtcaaagggtttatgtgcaccagttggctcggtgatcgttggaagtaaacaattcatc
acaaaagcaaaaagagtcagaaaattacttggggggggaatgcgacaagctggtgttctt
gctgcggctggaataatttctcttaatgtgataagcaagaagttgcacttggatcatgat
aatgcaaaacattttgcacaaactattctaagcttagcgccagatctggttgaagttaac
ttgaaacatgtaaccacaaatattgctatgtttcaacttaaaaatgcaatgccaacaaag
aatggccgaacagttgctcaagagtttgtttggcgaatggaaaacacatcagatggcagc
aaaacaagggttaagatgtgtgcctttggtgatgtaactgtcagagcagttttctatcac
caaataagcaagttggatgtccaaaaagcattggaaaaatttgaactagttgcttcggct
tggaggaatgaactttag

DBGET integrated database retrieval system