KEGG   Ciona intestinalis (sea squirt): 100187292Help
Entry
100187292         CDS       T01056                                 

Definition
(RefSeq) alcohol dehydrogenase-like
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00010  Glycolysis / Gluconeogenesis
cin00071  Fatty acid degradation
cin00350  Tyrosine metabolism
cin00830  Retinol metabolism
cin00980  Metabolism of xenobiotics by cytochrome P450
cin00982  Drug metabolism - cytochrome P450
cin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100187292
  Lipid metabolism
   00071 Fatty acid degradation
    100187292
  Amino acid metabolism
   00350 Tyrosine metabolism
    100187292
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100187292
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100187292
   00982 Drug metabolism - cytochrome P450
    100187292
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100187292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25 Sacchrp_dh_NADP Rsm22 Ubie_methyltran
Motif
Other DBs
NCBI-GeneID: 100187292
NCBI-ProteinID: XP_009860926
Ensembl: ENSCING00000012052
UniProt: A0A1W3JST0
Position
Un
AA seq 378 aa AA seqDB search
MMKKAEIVGLNKPLRIVQVDIPATPKKGAIVKVAYSGVCHSDIHQWDDCIDLGNTKIGLS
DAIGYKLPVVPGHEISGTVYSIGEEADAAAGLKVGDRVAVYPWIGCSKCGVCTHGKSECC
KERQLTIIGVGASSGGHSTHVAVTEVQFVVKLPDSIPLDLACMLPCSGLTTYNAVTSVLD
TVEKATLYHGKASVLIIGAGGLGLWSLRLAQALFPPTTEITVADISEEKLKVAKDRGCHD
TVFWDRSLSAADLHKATISKGNKGGFDAIMDFVNSQVTAERAFRCLKPYGLHVMVGLFGG
AATFPLPMLTLGARQIKGVYVGSLQQFNELIDLVSKNKLDPPPLNYFKLNDVTKAFTLLK
EGKINGRGLIKHDDKASL
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaaagcagaaatagtaggattaaacaaacctttacgtatcgtacaagtcgat
attcctgcaactccaaagaaaggagcaatcgtaaaggtagcatacagcggtgtatgtcat
tcagacatacaccaatgggatgactgtatcgaccttggaaataccaaaattggactttcg
gacgccataggatataaactaccagtcgttcctggacatgaaatctcgggaacagtgtat
tctatcggggaagaagcagacgcggcagctggtctaaaggttggtgatcgagtagctgtt
tatccttggattggctgcagcaaatgcggtgtctgcactcacggcaaatcagaatgttgc
aaagaacgacagttgacaattattggtgtgggtgcatcaagcggcggccactctacgcat
gtagcagtcacagaggttcagtttgttgttaaacttcccgattctataccactggacctt
gcttgtatgttgccatgctcgggtcttacaacttacaacgctgtaacaagtgtgttggat
acggtggagaaggcgacactttatcacggaaaagcatctgtgctgatcatcggtgctgga
ggtcttggtttatggagtctcagacttgctcaagctctctttcccccaacaacggaaatc
actgtcgcagatattagcgaggaaaaactgaaagtggcaaaagatagaggatgtcacgat
actgtcttttgggatcgttctctaagtgctgcggatttacacaaggctacaataagcaaa
gggaataaaggcggcttcgatgccatcatggatttcgtgaacagtcaagttactgcggaa
agggcgttcaggtgcttgaaaccgtatggcctgcatgtgatggtcggtttatttggagga
gctgcaacatttcctttaccaatgttgacacttggtgcaagacaaataaaaggagtttac
gtgggatctctgcaacagtttaacgagttaatcgacctggtatctaagaataagttggac
ccaccacctctcaactactttaagttgaacgacgttacaaaggcattcactctgttgaaa
gaaggcaagataaatggacgtgggctgatcaagcacgatgataaagcatctttgtaa

DBGET integrated database retrieval system