KEGG   Ciona intestinalis (sea squirt): 100187292
Entry
100187292         CDS       T01056                                 

Name
(RefSeq) uncharacterized protein LOC100187292
Organism
cin  Ciona intestinalis (sea squirt)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25 Sacchrp_dh_NADP FIST Ubie_methyltran
Other DBs
NCBI-GeneID: 100187292
NCBI-ProteinID: XP_009860926
Ensembl: ENSCING00000012052
Position
Unknown
AA seq 378 aa
MMKKAEIVGLNKPLRIVQVDIPATPKKGAIVKVAYSGVCHSDIHQWDDCIDLGNTKIGLS
DAIGYKLPVVPGHEISGTVYSIGEEADAAAGLKVGDRVAVYPWIGCSKCGVCTHGKSECC
KERQLTIIGVGASSGGHSTHVAVTEVQFVVKLPDSIPLDLACMLPCSGLTTYNAVTSVLD
TVEKATLYHGKASVLIIGAGGLGLWSLRLAQALFPPTTEITVADISEEKLKVAKDRGCHD
TVFWDRSLSAADLHKATISKGNKGGFDAIMDFVNSQVTAERAFRCLKPYGLHVMVGLFGG
AATFPLPMLTLGARQIKGVYVGSLQQFNELIDLVSKNKLDPPPLNYFKLNDVTKAFTLLK
EGKINGRGLIKHDDKASL
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgatgaaaaaagcagaaatagtaggattaaacaaacctttacgtatcgtacaagtcgat
attcctgcaactccaaagaaaggagcaatcgtaaaggtagcatacagcggtgtatgtcat
tcagacatacaccaatgggatgactgtatcgaccttggaaataccaaaattggactttcg
gacgccataggatataaactaccagtcgttcctggacatgaaatctcgggaacagtgtat
tctatcggggaagaagcagacgcggcagctggtctaaaggttggtgatcgagtagctgtt
tatccttggattggctgcagcaaatgcggtgtctgcactcacggcaaatcagaatgttgc
aaagaacgacagttgacaattattggtgtgggtgcatcaagcggcggccactctacgcat
gtagcagtcacagaggttcagtttgttgttaaacttcccgattctataccactggacctt
gcttgtatgttgccatgctcgggtcttacaacttacaacgctgtaacaagtgtgttggat
acggtggagaaggcgacactttatcacggaaaagcatctgtgctgatcatcggtgctgga
ggtcttggtttatggagtctcagacttgctcaagctctctttcccccaacaacggaaatc
actgtcgcagatattagcgaggaaaaactgaaagtggcaaaagatagaggatgtcacgat
actgtcttttgggatcgttctctaagtgctgcggatttacacaaggctacaataagcaaa
gggaataaaggcggcttcgatgccatcatggatttcgtgaacagtcaagttactgcggaa
agggcgttcaggtgcttgaaaccgtatggcctgcatgtgatggtcggtttatttggagga
gctgcaacatttcctttaccaatgttgacacttggtgcaagacaaataaaaggagtttac
gtgggatctctgcaacagtttaacgagttaatcgacctggtatctaagaataagttggac
ccaccacctctcaactactttaagttgaacgacgttacaaaggcattcactctgttgaaa
gaaggcaagataaatggacgtgggctgatcaagcacgatgataaagcatctttgtaa

DBGET integrated database retrieval system