KEGG   Ciona intestinalis (sea squirt): 108949601Help
Entry
108949601         CDS       T01056                                 

Definition
(RefSeq) serine/threonine-protein kinase WNK1-like
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
KEGG Orthology (KO) [BR:cin00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cin01001]
    108949601
   01009 Protein phosphatases and associated proteins [BR:cin01009]
    108949601
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108949601
Protein kinases [BR:cin01001]
 Serine/threonine kinases: Other
  Wnk family
   108949601
Protein phosphatases and associated proteins [BR:cin01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108949601
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C TFIIA
Motif
Other DBs
NCBI-GeneID: 108949601
NCBI-ProteinID: XP_018667929
UniProt: A0A1W5BAS9
Position
7
AA seq 1811 aa AA seqDB search
MSQNTKTEQQGSSYTTDHSKSNQTTVCTSPPTVKDSLIHQSVGESSDILVSSQIKQNEKN
SENVKSSEKLLIKEKEVLLLSEGSVKHVNSSASNGVLNVDGLNTSPSELPCVENDVGHTK
PASQSGSGSSQENVTENKAVSEVLTTEHTSEEFAMNGLNNTVEKNLNNQHNVEVPDSPSK
KDAVVNGNDQEGKMNGVVSDKDNKTDGVDASYKVNPLADGVAVGGEINVVSKDEEVADNA
LDDEINGGLEDDGKAIGESPDSRFLKFDIELGRGSFKTVYKGLDTDTGVAVAWCELQHHK
LSKNERLRFREEAEMLKGLQHPNIVRFYDSWDYQSLKGKKCIILVTELMTSGTLKTYLKR
FKSIKPKVLRSWCRQILKGLNFLHTRNPAIIHRDLKCDNIFITGPTGSVKVGDLGLATLK
RTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMITAEYPYSECINAGQIYRKV
TQGLPPNSFEKVQGKDERRIISICINRDKTQRYTVQQLLNEPFFVEVPGIKVELRSQAES
NAEPSQGEGENAMLKDTVTLRLVVEDAQRLKQKHKNDEALEFDFDMTKDIPVEVAKEMAQ
NGFLHEDDVNVVAKSITACLSSIQRNRRKIEENRQATFNDVKMNQTYQQQMQQQTLQQLQ
EQLHQTTNMSLSQPTNIQTNISQQQNTNQQIHQQPQFRQQIQPNIQQIPQQQFIPQQIIP
PVQQQFLQQQTNQHPQLIQQAINGQINNQQQIMQNPVMQNQASKTTHNQVFIESNIEEPD
RTINTVQDVVMSETESVATTDAGGESSKDSDKNRKEQKSEKKHRRQQKSRNRHWDKQLRI
LLLQVDGIERESDNDSDSVANNVTQGVDDDYLDKKLGHLSIECQIEIQGNLESIFKVDID
VESSQETASRLVVNNQLNEINKECFIEQLTLLCNRVRKGEFDGRPRLTITDIKTTEENLV
EVECQLTTYNLKTVTFKFIIDEDTPEEIADKMIQANYLKEKHTKAFQQQVRLVGIKAKQM
HDVGKIDVDLLKLEVNGCTSTAPLLPLSESVSATSLPPAEGGKTEENPVSKPEELSSSET
GSVIGSPRAEQVNEGISDPDPGKTVSSSSDVAESSEAAKPSMSNILFYRSPSCSSVASQQ
PQTQQQQQQQQQPVLKEASQISAPQPTHETTYNASQTETKTEAQEVRSDAKVIENAPLDA
AGAEEDQGSDVPTSQPITILPIGQPVILPQVIMVPKDTNDLDKQLTAILSHAQNTASTSE
GTDETTPVIGVVPVVIPVAMPINSSENADGNTLDIDNQLSAQDTATTNAASDSLTYQINT
NVKMTSALDDWGSPSVTTVVPLVVALSPPIGSTANFSPPLNEASQSSGDEAKTAGMVDQY
KVSDTESLVESVSSYHSEYQPVAQPHEERPVLQPETNFNRFQITKVNEDDSVKSLLREKM
NKIGVEETDTVVREVGRFQIIPTDSEVKSQPNTAHRQLSFENDKQPTKTLTESNKMDAEN
HQQSFETSFVHTNQQHTSVSLDASFNGSLASNHENATYMTSVASQQTSYEPSLVTETNSQ
SIVFTDGNTRVRTLSNNSEKSYSSLIGSDQGMQQEFVREQNLRMFTEQQYQRTNMNPGNP
LTPLTPIPIKPRDRQRMYLDSPTRSQYGELSEDETDGDDFDEDDSDFKDLSKRHQREIEA
LIRKHRLQLDRLRKAKKRQKMKVIPQKQPNPSKPDEAMSNHHEHSGTDFVSMETVELLSF
KYFLSHIISFTMGTPVLLIISFLSPRRPRPCPTPPDNQRPTPFTIPQKPALSFTRKTSAT
TTVQIQTRGTL
NT seq 5436 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaacacaaaaactgagcaacagggctccagttacactactgatcattcaaaa
tctaaccaaactacagtttgtaccagtccgcccacagttaaagactcactcatacaccaa
agtgttggggaatcttcggatattttggtgtcaagccaaattaaacaaaatgaaaaaaat
tcggaaaatgttaaaagttcggagaaattgttgataaaagagaaagaagtgttgttattg
tcagaaggttccgtaaaacatgttaatagcagcgcaagcaacggtgtgttgaatgttgat
ggtttaaatacttcaccgagtgagttaccatgtgttgaaaatgatgttgggcacactaaa
cctgcttctcaatctggaagtggaagtagccaagaaaatgtcactgaaaataaagcagtt
agtgaggtcttaacaacagaacatacatctgaagaatttgctatgaatggtctcaacaat
acagtggaaaaaaatcttaacaaccagcataatgttgaagtgcctgactcaccctccaaa
aaagacgctgttgttaatggtaatgaccaagaaggaaaaatgaatggagttgtcagcgat
aaagacaacaaaacagacggagttgatgcatcatataaagttaacccactcgcggatggt
gttgcagtggggggtgaaataaacgtcgttagcaaagatgaagaagtcgctgataatgca
ctcgacgacgagatcaatggcggtttggaagatgatggcaaagctatcggagaatctcct
gattcaagatttttaaagttcgatattgagctgggccgtggaagttttaagaccgtatat
aaaggccttgatactgacactggggttgctgttgcatggtgtgaattgcagcatcataaa
ttgtccaaaaatgagcggcttcgttttcgtgaagaagctgagatgttaaagggattacaa
catccgaacattgtaagattttatgactcatgggattaccagtcacttaagggaaagaaa
tgcattatacttgtcactgagcttatgacttctggaacattaaaaacgtatctaaaacgt
ttcaaatcaatcaaacccaaagttttacgaagctggtgccgtcagatactgaaagggtta
aattttcttcacacaagaaacccagctattatacatcgggacttaaaatgtgataatatt
ttcataactggacctacgggatcagtgaaagttggggatcttggccttgcaacattgaaa
aggacttcttttgcaaagagtgtaattggtacccctgagtttatggcacctgagatgtat
gaggaacattatgatgaaagtgttgatgtgtatgcgtttggtatgtgcatgttagagatg
attacagcggagtatccctactctgaatgtataaatgctggacaaatttatcgcaaagtt
acgcagggtcttccaccaaatagttttgagaaagttcaaggaaaagacgaacgtcggata
atttctatctgcatcaacagagataaaacacaaaggtacacagttcaacaactactaaac
gagccattctttgtggaggttcctgggataaaagtcgagctcagatcacaggctgaatca
aatgctgaacctagccagggagaaggcgaaaatgcgatgctaaaagacacagtgacgtta
cgtctcgtggtagaagacgcccaaagattgaaacaaaaacataaaaatgatgaagctttg
gagttcgatttcgacatgactaaggatatccccgtcgaagtagcaaaagaaatggcccag
aatggatttcttcacgaagatgacgttaatgttgtggcaaagtcaatcactgcttgttta
tcgagcattcaacgtaatcgacgaaaaattgaagaaaatcggcaagcaacattcaatgac
gttaaaatgaaccaaacctaccaacaacaaatgcaacaacaaactttacaacaactacaa
gaacaacttcatcaaacaacaaacatgtcgttgtcccaaccaacaaacatacaaacaaat
atctcccaacaacagaatacaaatcaacaaatacatcaacagccacaattccgacaacag
attcaacccaacattcaacaaatcccgcaacagcagtttatcccgcaacaaattatacca
cctgttcaacaacaattcttacagcaacaaacaaatcaacacccgcagttgattcaacaa
gcaatcaacggacaaatcaacaatcaacaacagataatgcaaaatcctgtgatgcagaat
caagcaagcaaaacaactcataaccaggtcttcattgaatcaaacatagaggaacctgac
agaaccatcaacactgtacaagatgttgtaatgtcggaaactgaatcagtggccacgacc
gacgctgggggtgaaagttcaaaagacagcgacaaaaatcggaaagaacaaaaaagtgaa
aagaaacatcgtcgtcaacagaaaagtcgaaacagacattgggataaacaacttcgtatt
ctattattgcaggttgatggtattgaaagggaatctgacaacgattcagattcggttgct
aataatgttacccagggagttgatgacgattatttggataaaaaactcggacatttatcc
atcgaatgtcaaattgaaatccaaggaaatcttgaaagtatatttaaagttgacattgac
gttgaatcttcgcaagaaactgcttcacgcttagtggtgaacaatcaactgaatgaaata
aataaagaatgttttattgaacaactgacattgctttgtaacagggttcgcaaaggcgag
tttgacgggcgtccaagattaacaatcaccgatattaaaacaaccgaagaaaatttagtt
gaagtcgaatgtcaactcacgacctataacctgaaaactgtcacttttaagtttatcatt
gacgaggatacccctgaagaaatcgctgacaaaatgatccaagcaaactatttaaaggag
aaacacaccaaagcttttcaacaacaagtacgtttggtcggaatcaaagcaaagcaaatg
catgatgttggaaaaattgatgtcgatcttctgaagttggaggttaacggatgtacctcc
actgctcctctgcttccgctctctgaatctgtgtccgcaacctcccttcctccagctgaa
ggcggaaagacggaggaaaatcctgtttcaaagccggaggagttaagcagcagtgagacg
ggctccgtgatcgggtctcctcgtgccgagcaagttaacgagggcataagtgatcctgat
cctgggaagacagtgagcagctcctcggatgttgcagagtcgtcagaggcagcgaaacca
tcaatgagcaacatcttattttatcgctcgcccagttgttcaagtgttgcgagtcaacaa
ccacaaacccaacaacagcaacaacaacaacaacaaccagttttaaaagaagcatcgcaa
atatcggcccctcaaccaacgcacgaaacaacttacaatgcttcgcaaactgaaaccaaa
accgaggcacaagaagttagaagtgatgcaaaagttatcgaaaatgctcctctggatgct
gcaggagcagaagaggatcaaggatcagatgtcccaacatcccaaccaatcaccatcctc
ccaataggacaaccagtaattcttccacaagtgatcatggtacctaaggatacaaatgat
ttagataagcagttaacggcaattttatcccacgctcaaaataccgcttctaccagtgaa
ggaacagatgaaacaacgcctgttattggcgtggttcctgtagttattcccgttgcaatg
cctattaactcttctgaaaacgctgacggtaatactttagatatagacaaccaattgagt
gctcaagatacagcaacaactaatgcagcttctgatagcttaacctaccagattaatacc
aatgttaaaatgacttccgctttagatgattggggaagtccatctgtaactacagtagta
cccctggtagtagcactgtccccaccaattggatctacggcaaacttttcgcccccttta
aacgaagcaagccaatcttctggggacgaagctaagacagcgggtatggtggatcaatac
aaagtgtccgacactgaaagtttagttgaatcagtttcatcctaccactctgagtatcag
ccggttgctcagccacatgaagaaagacctgtacttcaacccgagacaaattttaatcgc
ttccaaatcactaaagtgaatgaagatgattcggtaaaatcgctgctgcgcgaaaaaatg
aacaaaattggggtcgaggaaacggatacagttgttagggaagtcggcaggtttcagatt
atcccaacagattcagaagtcaagtctcaacctaacactgctcacaggcagcttagtttt
gaaaacgataaacaacccaccaagacacttactgagtcaaataaaatggatgcagaaaat
catcagcaaagttttgagaccagttttgtccacactaaccagcagcatacgtcagtctca
cttgatgcttcctttaatggatcacttgcttctaatcatgaaaatgcgacgtacatgact
tcagttgccagtcaacaaacttcttatgagccatctctagttactgaaaccaactcgcaa
agtattgtgtttaccgatgggaacacgagagtccgtactttgagcaacaacagcgagaaa
agttattcctcattaattggttctgatcaaggaatgcagcaagaatttgttcgtgagcaa
aacttaagaatgtttactgagcaacaataccaacgaactaacatgaacccgggaaacccc
cttacccccctcaccccaattcccataaaaccccgggatcgtcagcgaatgtatcttgac
tcacccacccgctcacaatacggggaactcagcgaggacgaaacggacggcgacgatttt
gacgaggatgattctgattttaaagatcttagcaaaaggcatcaacgtgaaattgaagct
ttaataagaaaacatagattgcaattggaccggttgcgaaaagccaagaagcgacaaaaa
atgaaagttataccccaaaaacaacctaatccttcaaaaccagatgaagccatgtctaat
caccatgaacacagtggaacagactttgtttcaatggaaactgtggaacttctttctttt
aagtattttctctctcatatcatctcattcactatgggcacaccagttttattgataatt
tcattcctcagccccaggaggccacgcccatgtcccacccccccagacaaccagcgccca
acaccattcaccatcccgcagaaaccagcgctttcgttcaccagaaaaacttcagcaaca
accaccgttcaaatacaaactcgtggaaccctctaa

DBGET integrated database retrieval system