KEGG   Ciona intestinalis (yellow sea squirt): 445749
Entry
445749            CDS       T01056                                 
Symbol
ck2a
Name
(RefSeq) casein kinase 2 alpha subunit
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
cin  Ciona intestinalis (yellow sea squirt)
Pathway
cin03008  Ribosome biogenesis in eukaryotes
cin04137  Mitophagy - animal
cin04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:cin00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    445749 (ck2a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    445749 (ck2a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    445749 (ck2a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cin01001]
    445749 (ck2a)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cin03009]
    445749 (ck2a)
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     445749 (ck2a)
Protein kinases [BR:cin01001]
 Serine/threonine kinases: Other
  CK2 family
   445749 (ck2a)
Ribosome biogenesis [BR:cin03009]
 Eukaryotic type
  90S particles
   Kinase
    445749 (ck2a)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH ABC1 Kdo Pkinase_fungal Choline_kinase DUF5898
Other DBs
NCBI-GeneID: 445749
NCBI-ProteinID: NP_001027720
Ensembl: ENSCING00000009515
UniProt: Q8T3S5
Position
3:complement(2035344..2043877)
AA seq 385 aa
MAIPSRARVYHDVNTHRPREYWDYESHVVDWGNQDDYQLVRKLGRGKYSEVFEAFNVTDN
KKVVIKILKPVKTKKIKREIKILQNLRGGGPNIITLLDIVKDPVSRTPALVFEHVNNIDF
KQLYQTLTDYDIRYYMFEILKALDFCHSMGIMHRDVKPHNVMIDHENRKLRLIDWGLAEF
YHPGQEYNVRVASRYFKGPELLVDYQFYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQ
LVRIAKVLGTEDLYEYLDKYNIELDPRFNDILGRHSRKRWERFVHSDNQHLVSPEAIDFL
DKLIKYDHQARLTARESMEHPYFYPVVKDQGGLSSNATLPSSSTQLGQVQMGSGMCLGGI
TSTTGVLKDSPGGSIRQSNTAQSMN
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggcaattccaagtcgtgcccgtgtttatcacgacgtcaacacccaccgacccagagaa
tattgggattatgaatcacatgtcgttgactggggaaaccaggatgactaccaacttgtt
cgaaaactgggaaggggtaaatacagtgaagtatttgaagcatttaacgttacagacaac
aaaaaagttgttataaaaattttaaagcctgtaaagacgaagaaaatcaaacgtgaaatt
aaaatcttgcaaaacttacgaggaggtggccccaacattatcacactccttgacattgtg
aaagatccagtgtccagaactccagcgttggtgttcgaacatgtcaataatattgacttc
aagcaattgtaccagacattaacagactatgacatccgatactatatgttcgaaatacta
aaggcacttgacttctgccacagtatgggtataatgcacagagatgtaaaaccacacaat
gttatgatcgaccatgagaatagaaagcttcgtttaatagactggggattagctgagttc
taccaccctggtcaagaatataatgttcgagtggcatctagatactttaaaggacctgaa
cttcttgtggactaccaattttacgattactcacttgacatgtggagtctgggctgcatg
cttgcttcaatgatatttagaaaggaacctttctttcatggccatgacaattatgaccag
ctggttcgcatagccaaggttcttggaactgaagacttgtatgaatatcttgacaaatac
aacattgagttagatccaagattcaatgatatacttggaagacactcccggaagagatgg
gagagatttgttcacagcgacaatcagcatcttgtaagtccagaggcgattgacttcctc
gataaattgatcaagtatgatcaccaagcacgactcactgctcgtgaatccatggaacac
ccctacttttacccagttgttaaggatcaaggaggtctttcatcaaatgcaactttgcct
tcttcttctacccaactcggccaagttcaaatgggatcaggaatgtgccttggtggaata
actagcacaactggagtcctaaaggattccccaggcggttccatccgacaatccaacaca
gctcaatcaatgaattaa

DBGET integrated database retrieval system