KEGG   Ciona intestinalis (sea squirt): 445769Help
Entry
445769            CDS       T01056                                 

Gene name
elk
Definition
(RefSeq) Elk protein
Organism
cin  Ciona intestinalis (sea squirt)
SSDB OrthologParalogGFIT
Motif
Pfam: Ets
Motif
Other DBs
NCBI-GeneID: 445769
NCBI-ProteinID: NP_001116439
Ensembl: ENSCING00000002179
UniProt: Q4H3N0
Position
8
AA seq 946 aa AA seqDB search
MMTLKIDTADFDRSSIEQQPQQDGKCNNSGHKSTETRNVTDSAVENDRIKSSDPEKGLLD
RENDGSPSLDERSSMVNMEEIDMQAPPSDKRLCLANMQQLGAHLPRVLDMNVTLWQFLLE
LLMDPSSNSHLISWTSADGEFKLHNSEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNII
KKVNGQKFVYKFVSFPEIIKTETKIPFRVKMERLTQNENGQGGIDDDDEGDPPSPTPSSS
PPSMVVGRSDVTEEDYRYFIQRQQEAKELEQAEKRKKLSHQNEQRQEQRRQLKQLNYSNY
SPTQSPADNWRHREMAEESHHATGSLQHATRSVEDVARMSLGAASSAAAAAAAAALSATQ
EERARNAAATAAFWAGFRQAAAAAVVASTSKPEDPLLTQRYLQAGERQNSGRKYHTESPP
INPRGWDRHNSNNNHRSNTHSYRQQQHNDKYKHDRLSPPYPTQFHKSRKSPPKDTVSQYQ
QYLQQYEKDYSLSMSHHRFKEQPEHTPEELINHNKKALAEAFMARAPQINKPRPRSPYSS
GQKRRYPGEDDVMDVRRRDPSLFCSRLEQDDIPASSNRSSIELKRPKMECSDISSNAFPF
ADNFSSYSRELVGKSPPLPRPFDERNEHAESTLAMLMNGHNSAPIENTSNTNTLKRNSLN
EAPLDLCTSPKASNSPPGSPRALSPMLKHSPPVSSMDGDTSRTEEKRKSPELLPAPEQRE
DEELEKTKQDSGPVTPQKRRLTGKKSIDRKPSPIDLSKPTRTEADDYMDGISSALYAQFP
GIRGSSLLSHDGKSINTPDAVSRKTPSDTNATFFPTSVIMTPSPMVIPSITFWSTLSPMP
PHGLGKTDLLAGVREGCSSKSTNNDSKDGEGEKDQKAGSVFQFPTVVNGQMTFAGVPVRP
IAAALGQPIPANQVSSVASQLTSHMTGVASPLNLVSSSAVTTLTSS
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgatgacattgaaaatcgacacagccgatttcgatcgctcgtccatagagcaacaacca
caacaagacggcaaatgcaataacagcggtcataaatcaacggaaacgcgtaacgtcaca
gattccgctgttgagaacgacaggattaaaagttcggacccggagaaaggtttattggac
cgtgaaaatgacgggtccccatcgttggatgagcgttcttcgatggtaaatatggaggaa
atcgacatgcaagcaccgccttctgacaagcggctgtgccttgccaacatgcagcaactg
ggagcccatttaccaagagtgctggatatgaacgtaacactgtggcaatttctgctcgaa
cttctcatggaccccagcagcaacagtcatctaatcagttggacctccgcggatggtgaa
ttcaagctccataattccgaagaggttgctcggctctggggccttaggaagaacaagacg
aatatgaactacgataaactgagccgagcgctgcgttactattacgataagaatatcata
aagaaagtgaacggacagaagttcgtgtacaagttcgtgtctttccctgaaattataaaa
accgaaaccaagattccatttcgggtaaagatggaaagacttacccaaaacgaaaatgga
caggggggtatagatgatgacgacgaaggggaccccccctcacccacaccatcttcatca
cccccctcaatggtggtgggccgtagtgacgtcacagaggaagattatcgctacttcatc
caacgtcagcaagaagcaaaagaattagagcaagcggaaaaacgaaaaaagctgagccat
caaaacgaacaaagacaagaacaaaggcggcagctgaagcaactgaactattccaactac
tcccccacgcaatcgcccgcggataattggagacaccgcgagatggcggaagagagtcac
cacgctactggatctcttcagcatgcaacacgttctgtagaagatgtagctcgcatgtcg
ctgggtgcggcgtcctctgcggcagcagctgctgccgcggccgccctgtcagcaacgcaa
gaggaacgtgcccgtaacgctgcggcaacggcagctttctgggctgggttcagacaagct
gctgcagccgctgttgtagcttcaacatctaaaccagaagatccactgcttactcagcga
tacttacaagcaggtgagagacaaaactccgggcgaaaataccacaccgaaagcccacct
atcaaccctagaggatgggaccgccacaatagcaacaacaaccaccgttccaacacacac
agctaccggcagcaacaacacaatgacaaatataagcacgaccgactgtctcccccgtat
ccaactcagttccacaaatctcgtaaatctccacccaaagacacagtttcgcaatatcag
caatacctgcaacagtacgagaaagattactctcttagtatgagccaccaccggtttaaa
gagcaaccagaacatacgccggaggaacttatcaaccacaacaaaaaagcgctggctgaa
gcgtttatggcaagagctcctcaaataaacaagcctcgcccacgaagtccttacagcagt
ggccagaaaaggaggtatccgggagaagatgacgttatggatgttaggcgtcgcgaccct
tcacttttttgttctcgactcgagcaagatgacattcctgcatcctccaaccgatcaagc
attgagttgaagcgtccaaaaatggaatgcagcgacatcagctccaacgcatttcctttc
gccgacaattttagctcatactcccgcgaacttgttggaaaatcaccccctctcccgcga
cccttcgacgaaagaaacgagcatgcagaatcaaccttggcaatgctaatgaacggccat
aattcagcacctattgaaaacaccagcaatactaataccttaaaacgaaactccctgaac
gaagcgcctttggatctctgcacttcacctaaagcgtccaactcgcctccaggcagtcca
cgagcactttccccaatgcttaaacattcccctccagtttccagcatggacggcgatact
tccagaacggaagagaaaagaaaatctcctgagctactccctgctcctgagcaacgggag
gacgaggagctcgaaaagacgaaacaagactccggaccggtgactccacaaaaaaggcga
ctcactggcaaaaagtcaatagaccgaaaaccttcccccattgacttaagtaaaccaact
cgtacagaagctgatgattacatggatgggatatcttcagctctgtacgcgcagtttcca
ggcatccgaggatcatctttgttatcacatgatggaaaaagcatcaatactccggatgcg
gtgagcaggaagacaccatccgacacgaacgctactttctttcccacttcagtgatcatg
actccatcgccaatggtgatacctagtattacattctggagcaccttaagcccaatgccg
ccacatgggttagggaagactgaccttcttgcgggagtccgtgaaggctgctcttccaaa
tcaacaaacaacgattcaaaagacggggaaggggaaaaagaccagaaagccggttcagtc
ttccagtttcctacagtggtaaacggccagatgacattcgcgggcgttcctgtgcgaccg
attgctgccgcacttggccagcctatccctgccaaccaagtgagcagcgtagcttcccag
cttacttcgcatatgacgggggtggcttctccccttaatctcgtatccagttctgccgtc
acgacactaacttcatcgtaa

DBGET integrated database retrieval system