KEGG   Ciona intestinalis (yellow sea squirt): 778585
Entry
778585            CDS       T01056                                 
Symbol
e2f4/5
Name
(RefSeq) transcription factor protein
  KO
K04682  transcription factor E2F4/5
Organism
cin  Ciona intestinalis (yellow sea squirt)
Pathway
cin04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:cin00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    778585 (e2f4/5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cin03000]
    778585 (e2f4/5)
Transcription factors [BR:cin03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    778585 (e2f4/5)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TrmB
Other DBs
NCBI-GeneID: 778585
NCBI-ProteinID: NP_001071688
Ensembl: ENSCING00000024912
UniProt: Q4H3N4
Position
6:complement(1817912..1820026)
AA seq 269 aa
MADLASTSRHEKSLGLLTTKFVHLLKNAQNGVLDLKMAADELAVRQKRRIYDITNVLEGI
GLIEKRSKNSIQWKGAGPECNDGDIAEKINILRQEIQSLEQTELDLDRQKTGVHQSLRNV
TDDVDNNKLAYVTHEDLCRCFPGDTLLAIQAPSGTQLEVPIPEMADPNKRYQVHLKSTSG
PVSVLLVNKDTSSPAVVVPVPPPPQAEAAKPTELPLPSMQTDTNFLDDFPCSDTFEPLLS
LSPLPSDQDYYFNLDMSEGACDLFDISLP
NT seq 810 nt   +upstreamnt  +downstreamnt
atggccgatttagccagcactagtcgtcatgaaaagtcgttaggtcttttaacaaccaaa
tttgtgcatttgctgaaaaacgcacaaaatggggttttggacttgaaaatggctgcagac
gaactggctgtgcggcaaaaacggaggatctatgacatcacaaacgtccttgaaggaatt
ggacttatcgaaaaacggtcaaaaaacagtatccagtggaaaggagctgggcctgagtgc
aatgacggggacatagccgaaaaaattaacattttacggcaagaaatacaatcgctcgaa
caaactgagctagacctggatcggcagaagactggcgtacatcagagcctacgtaatgtc
actgacgatgtggataataacaaacttgcatatgtaacacatgaggacttgtgtcgttgt
tttccaggagatacactgcttgcaatacaagcaccatctggaacccaactagaagttcct
ataccagaaatggctgacccaaataaaagataccaagttcaccttaaatctacctctggc
cctgtatccgttctattagtcaacaaagacacaagtagtcctgctgtggtggtacctgta
ccccctccaccccaagctgaagcagctaaaccaacagagttgcctctaccaagcatgcaa
actgacactaactttttagatgattttccatgcagtgatacatttgagccactactcagt
ctttccccactaccttcagaccaagactattacttcaacttagatatgagtgagggtgcg
tgcgacctttttgacatttcgctgccgtaa

DBGET integrated database retrieval system