KEGG   Ciona intestinalis (sea squirt): 778646Help
Entry
778646            CDS       T01056                                 

Gene name
hox12
Definition
(RefSeq) transcription factor protein
Organism
cin  Ciona intestinalis (sea squirt)
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 778646
NCBI-ProteinID: NP_001071736
Ensembl: ENSCING00000007040
UniProt: Q4H3D0
Position
7
AA seq 484 aa AA seqDB search
MTAKVFSGDYHYNMSFAFGDTTSEQEADSLFSSAGPSQENITQPEEPLQVPAKVTSCSSV
HVTEQLAYFNPMRVNDSYPMSEHVPSYGRDVSQQPLKKWESYSAKGLTPTLATPAAKTDV
QQSTYAAMPKNGKPAPSSLTEACGVLRGSEYERSTIPYYGTSAHVRQNIGKSDNGIVSAL
RTSPIIRSPIVTERENGRSLSTSGSDSGAHGNLVQSAPPRTISDLPNLNSGYPSTDNPFR
CLPDSGDAFKGLTACGSMLSQSTCQEQRYTLPHSTIHTEHPFDHPGHSSMSVTYANDSLY
FGSMDHYGSQLSARQYPQFVTHPYYPHYPAPSLHHTDFATSTIPNQVVAHDHVALLPHHH
HPAAAAYSHPYQTVLPGQHYPVDVTRHGAQRRRRRPYTKYQLSELEREFGANEFISREMR
EQIAVRVGLNDRQVKIWFQNRRMKKKRMQHRGEQSVEDEDQLGMTEEPDLQLGAVPHCEN
YMTG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaaaggtttttagcggcgactatcactacaatatgagttttgcattcggagac
actacatccgaacaagaagcggactctctcttttcctccgcaggaccgagccaagaaaac
atcactcagccggaagagccccttcaagttccggccaaagttacatcttgctcatcggtg
catgtaacggagcaactggcttatttcaacccaatgcgagtcaacgattcttacccgatg
tctgaacacgttccaagttacggtagagacgtctcgcagcaacctttgaagaaatgggag
tcctatagcgccaagggcctgactcccacactggcgacacctgctgctaaaaccgatgta
cagcagtctacatacgcagccatgccaaagaacggtaaaccagcccccagttctctaaca
gaagcatgcggtgttttaagaggcagtgaatatgagcgctcaaccatcccatactacggt
acctctgctcacgtccggcaaaacattggaaaaagcgacaacggcatcgtctcagctctc
cgcacgtctcccataattcgttcgccgatcgtcaccgaaagagaaaatggccgctcgcta
tcgacttcaggttcagactccggcgcccacgggaatctggtgcagtcggcgccgccgaga
acaatctcggatctccccaacctgaacagcggttacccgtcgaccgacaacccatttcgt
tgcttacctgatagcggtgatgctttcaaaggccttactgcatgcggtagtatgttaagt
caatcaacctgtcaggaacaaagatacacccttccacattcaaccatccatactgaacat
ccgttcgaccaccccggccactctagcatgtccgttacatacgccaacgacagtttatat
tttggttcaatggatcattacggctcacagctaagcgcgaggcagtaccctcaattcgtc
acccacccttactacccccattacccagctccttcattacatcatacagattttgcaact
tccacaattccaaatcaagttgtagctcacgaccatgtagcactactaccacaccaccat
catccagctgcagcagcctacagtcatccataccaaactgttcttcctggtcagcattac
ccagtagatgttacaagacatggagcccagagaaggcgtcgaaggccatacactaagtac
caactttccgagctagaaagagagttcggagcgaacgaattcataagccgagaaatgcga
gaacaaattgccgttagagtgggcttgaacgaccggcaagttaaaatctggttccaaaac
cgaaggatgaagaaaaagagaatgcagcaccgtggggagcagtctgtagaggacgaagat
caactagggatgacagaagagcccgatcttcagttaggtgcggttcctcactgtgagaat
tacatgacgggctag

DBGET integrated database retrieval system