KEGG   Ciona intestinalis (sea squirt): 778770
Entry
778770            CDS       T01056                                 

Gene name
stat-b
Definition
(RefSeq) STAT-b protein
  KO
K11224  signal transducer and activator of transcription 5B
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:cin00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    778770 (stat-b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cin03000]
    778770 (stat-b)
Transcription factors [BR:cin03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    778770 (stat-b)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2 TetR_C_13
Other DBs
NCBI-GeneID: 778770
NCBI-ProteinID: NP_001071828
Ensembl: ENSCING00000004044
UniProt: Q4H2R0
Position
1
AA seq 805 aa
MSLWAKVRELEGDSLRQIQNLYGPNFPIEFRHYFADIIERQQWDQLDPDNIPQDEPHAKY
ILGLFLEEIQKQCDSLTEGKDFLQRLHFSEIASHFKNVYGPAPLELVRTVKKILSIETRL
VQHASSLMDGGMHMRNNQQSEKVSHINSELERLAAMTRDTENDLRQLQSKQEYFVINYQD
SLKISSELQQIQQLDPSNPARQYETQLTRKQAEVDKLLRAEAQKLQQLRASLATRHEETF
NHLSQLQNQILDEELIKWKRSQALAYNGVQHESNLDQLQQWCEQLAEIIWQNRQQIKRVE
LQRQQLPINNPGRDMLPDLNATITALLSTLVTSTFIIEKQPPQVLKTQTRFGATIRLLVG
GKLNVHMNPPTVKASIISENQAKALLKNDSSRSITEMSGEILNPESVMEYHTQSGILSVN
FRNMSLRRIKRSDKRGAESVTEEKFTILFQSRFSIGGNELVFQVRTLSLPVVVIVHGNQE
ANAAASILWDNAFAEQGRVPFHIPDKVPWCKLIDTLDYKWKHECHTSRGLTPQAKQYLAH
KVFRQNVSSNSDKQISWAQFNREPLPNRNFTFWQWFNGVMELTKSKHLQKHWDDGAIIGF
IGKGDSQDKLVSKSLASFLLRYSDSEIGGLTIAWVADSDKAPGVPRVWNLQPQTLRDYGI
RSLADRIKDLDQLMYIIKSDNTTQLKDEVFGQYYSKTISSSPQGDGYVRTELMQHIPNSN
QLNMSNMGDHSAPNTPASSYEAQLSIHSPNNVPHHNNIQYDVPDMNMVNNFQQQNDVTGN
MEYDETLECFGPCNIDVNELLSRQL
NT seq 2418 nt   +upstreamnt  +downstreamnt
atgtcattatgggccaaagttcgcgaactggaaggagattctttgaggcaaatccagaat
ttatacggaccaaacttccctattgagtttcgtcattattttgctgacatcatagaacga
caacaatgggaccaattggaccccgacaatattccccaagatgaaccacacgcaaaatac
atccttggtttattccttgaggaaattcagaaacaatgcgattccttgacagaagggaag
gactttctgcagagacttcatttcagtgagattgcttcacattttaaaaatgtatatgga
cccgcaccattggagcttgtaaggacggtaaagaagattctatcgattgaaacacggctt
gttcaacatgcaagttcgcttatggatggtggaatgcatatgaggaacaaccaacaatct
gagaaggtttcccacattaacagtgaattggaacgtttagcagccatgacgcgagacacc
gaaaatgatttgaggcaactgcaatcgaaacaagaatatttcgtgatcaattatcaggac
agtctgaagatatcttctgagctgcaacagattcaacaacttgatccttctaaccctgcc
agacagtacgagacgcaactaacaaggaagcaagctgaggtagacaaactgctacgtgcc
gaagcgcagaaactgcaacagttacgagcgagtcttgctactcgccatgaagaaacattc
aaccatcttagccaactacagaaccaaatacttgatgaggaattaatcaaatggaaaaga
tcgcaagctctcgcttataatggggtccaacatgagagtaacttggaccaactgcagcaa
tggtgtgaacaactagcggaaataatctggcagaaccgacagcaaataaagagagttgag
cttcaacgccaacagcttcccattaacaaccctggcagagacatgctgcccgatctcaat
gctacaatcactgctctgttgtctactttggttaccagcacctttatcatcgagaaacag
ccccctcaagtgttgaaaacacagacaaggttcggagctacgatccgtttgctggttggt
ggaaagcttaatgttcatatgaatccccccacagttaaagcgagcatcataagcgagaat
caagcaaaagctctgctcaaaaacgactcgagcagaagcatcactgagatgagtggagaa
atattgaacccggagtcagtgatggaatatcacacacaatctgggattttaagcgtcaac
ttcagaaacatgtctctacggcgaatcaaacgttcggacaagcgaggagctgaatcagta
actgaggaaaagttcaccattttgtttcagtctcgattcagcattggtggaaatgagctc
gtgtttcaagtcaggacattatcattaccagttgtagtaatagttcatggcaatcaagaa
gcaaatgctgctgccagtattctatgggataatgcattcgctgagcagggtcgagttccg
tttcacatcccggacaaagttccatggtgtaagttgattgacactctcgattataaatgg
aagcatgagtgtcatacgtccagaggtctcactccacaagcaaaacaatatctcgctcac
aaagttttcagacaaaatgtctccagcaactcagacaagcaaatatcatgggcccagttc
aacagggagccactacctaacagaaactttactttctggcaatggttcaacggagtgatg
gaacttactaagagtaaacacctacagaagcattgggatgatggagccatcataggcttc
attggcaagggcgattctcaggacaaacttgtttcaaagtctctcgcaagttttctactc
cgatattctgactctgaaattggaggtctgactattgcgtgggtggctgactcggataaa
gctcctggagttcctcgtgtttggaacctccagccccaaaccttacgtgattatgggata
cgttcgttggctgatcgtatcaaggatttggatcaattgatgtacataattaagtctgac
aacacaacgcaactgaaagacgaagtgttcgggcaatattacagcaagacaataagtagt
tcaccgcaaggagatggatatgtgaggactgaactgatgcagcatattcctaacagcaac
caattgaacatgagcaacatgggcgaccacagcgcacccaacacaccagcaagcagctac
gaagctcaactatcaatccacagccccaataacgttccacatcacaacaacatacagtat
gacgtacccgacatgaatatggtgaacaactttcaacagcagaatgacgtcacaggcaac
atggagtatgacgaaacacttgaatgtttcgggccgtgcaacattgacgtcaatgaacta
ctcagtcgccagctgtga

DBGET integrated database retrieval system