KEGG   Ciona intestinalis (yellow sea squirt): 778892
Entry
778892            CDS       T01056                                 
Symbol
zf(ring)-30
Name
(RefSeq) zinc finger protein
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
cin  Ciona intestinalis (yellow sea squirt)
Pathway
cin04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cin00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    778892 (zf(ring)-30)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cin04121]
    778892 (zf(ring)-30)
Enzymes [BR:cin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     778892 (zf(ring)-30)
Ubiquitin system [BR:cin04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    778892 (zf(ring)-30)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     778892 (zf(ring)-30)
SSDB
Motif
Pfam: WD40 zf-C3HC4_2 zf-C3HC4 ANAPC4_WD40 zf-C3HC4_3 zf-RING_UBOX zf-RING_5 zf-RING_2 WD40_like zf-C3HC4_4 zf-RING_10 Prok-RING_4
Other DBs
NCBI-GeneID: 778892
NCBI-ProteinID: NP_001071934
Ensembl: ENSCING00000006174
UniProt: Q1RPU5
AA seq 645 aa
MKRSSSGSSIKPTVPENATPLQPTVLGSYREMNSDFICPICFNLIEEAYMTKCGHTFCYN
CLKKSLEQSNKCTKCNSALSKTDEIYPNYLLNNLIQKKKKKMDEMLACSKRMKIDSRLWE
WQSLLATEDDDIHLADIDQMLKLLQEKRRRLVQESAVAHNQVLLEFLFELKKQKQTALER
ARTELSVVETDISRVEEALERGVDKTLLDSVVPDDNDENIKKEQLVPKPHSSEPSTSSAA
GSSSETSIETFNQLSQKSKDEESSLHRTVAKRRCRLHAHFDDLHECYYNTRLCEIAPVEE
RNVELLGDFSNKLRRFTQFSSIRAVASLSYASDILNQSSIVSSIDFDKDCDHFAVAGVTK
KIKVYDYESVVNNVIDGVNCPIVQMACNSKISSISWSHYHKSWLASSDYEGSVILWDAFT
GQKNKVFQEHEKRCWSVDFNSVDPRLLASGSDDARVKLWSTGVQRSVACIEAKANVCCVQ
FNPHSAFHLAFGCADHFVHYYDIRNTKQSVSVFRGHKKAVSYAKFVDKDEIVSASTDSEL
RLWKTSTSPCVRSFRGHTNDKNFVGLATNGDYIACGSENNSLYIYYKGLSKSLLTYKFNV
VKSVLDREQTDDDSNEFVSAVAWRANSDIIAAANSQGTIKILELI
NT seq 1938 nt   +upstreamnt  +downstreamnt
atgaaacgttcttcaagtggcagttcaataaaaccaaccgtgccagaaaatgccaccccg
ttacaaccaacagtgcttggttcttatagggaaatgaacagcgactttatttgtccaatt
tgcttcaatttaatagaggaagcatatatgaccaagtgcggacacactttttgctacaat
tgccttaagaagagcctagaacaaagcaacaaatgtacaaaatgtaactcagctctgagc
aaaacagatgaaatctaccctaattatcttcttaataatctgattcaaaagaagaagaaa
aaaatggatgagatgcttgcttgttcaaagcgcatgaaaatagacagtcgcttatgggag
tggcagtcattactggccactgaggatgatgacattcaccttgctgatattgatcaaatg
cttaaactgctgcaggaaaaacgacggcgtttggtgcaagaaagtgcagtggcacataat
caagttctgcttgaatttctttttgaattaaagaaacagaagcaaactgctttagaaaga
gcaagaaccgaactctctgttgttgagactgatattagtcgagtagaggaagcattggaa
agaggtgtggataaaacattgttggattcggttgtaccagatgataatgatgaaaatatc
aaaaaagaacagttggttccgaaacctcattcctcagaaccttcaacatcatcagctgca
ggttcttcatctgaaacgagcatcgaaacatttaatcaactgtcacagaaaagcaaagat
gaagaaagttcattgcatcggaccgtggcaaagagaagatgcagattacatgctcacttt
gatgatctgcatgaatgttattacaacactcgactttgtgaaattgctcctgtggaagaa
aggaatgtagaacttctgggtgattttagcaacaagcttcgaagattcacgcaattttca
tcgattcgtgcggtggcttcgcttagttatgccagcgatattttgaaccagtccagcatt
gtttcaagcattgacttcgataaagattgtgatcattttgctgttgcaggtgtcaccaag
aaaattaaagtctacgattatgaatctgtggttaacaacgtcattgatggcgttaattgt
ccgattgtgcaaatggcatgcaactcaaaaatttcttctatcagttggagccactaccat
aagtcatggttggcgagcagtgattatgaaggttctgtgatcttgtgggatgcctttaca
ggtcagaaaaacaaagtgtttcaggagcatgagaagcgatgttggagcgtagactttaac
agtgttgatccaaggttgctcgcttctggttcagatgatgctagggtaaaactatggtct
actggggttcaacggtctgttgcttgcattgaggcaaaagcaaatgtatgttgcgttcaa
ttcaacccacacagtgcatttcatttggcatttggctgtgctgaccattttgtccattac
tatgatattcgaaacacaaagcaatctgtgtctgtttttcgcggacacaagaaggctgtt
tcgtacgcaaagtttgtggataaagatgaaattgtgtctgcctcaaccgacagcgagctt
cgcttgtggaaaacttcaacctctccttgtgttcgatccttccgtggacataccaacgac
aaaaactttgttggacttgcaaccaacggcgactacattgcttgtggtagcgaaaacaac
tccttgtatatttactacaaaggattatctaagtctttgttaacatacaaattcaatgtt
gtgaaaagtgttcttgaccgagaacaaacagatgatgacagcaatgagtttgtgagtgca
gttgcgtggagggctaacagtgacatcattgcagctgccaatagtcaaggaacaataaaa
atattagaactaatataa

DBGET integrated database retrieval system