KEGG   Ciona intestinalis (sea squirt): 778915Help
Entry
778915            CDS       T01056                                 

Gene name
ephrina-b
Definition
(RefSeq) ephrin precursor
Organism
cin  Ciona intestinalis (sea squirt)
SSDB OrthologParalogGFIT
Motif
Pfam: Ephrin AJAP1_PANP_C Mucin
Motif
Other DBs
NCBI-GeneID: 778915
NCBI-ProteinID: NP_001071949
Ensembl: ENSCING00000010080
UniProt: Q4H3M1
Position
3
AA seq 265 aa AA seqDB search
MPLSKVNRMILSLFMCYLLFDGVRSKRFNSGTITHEVMWDPRENGGFAFGNEFSIEVHMR
DYMNIHCPQYDQDDKAKLSFIIYNVSEQSYNSCSLTDMKTAIFKCDNPVKGRKLTTKFQR
RSPNPLGFVYQPNKDYFFMAFKKDEPQNCKSAMKMKVHVLPKRLHEHDRKPVTAGTTRSS
TPRTLSSTTTTTTIATTTTTTPRTSQKPHIPRQSSTRNTPPTKTLKPGYVRGDGEGDGPG
GGVGRITCATTWMLVALVLTVLLQN
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcctttgtcaaaagttaatcgaatgattttaagtttgtttatgtgctatcttctcttt
gatggggtacgaagcaagcggtttaattcggggaccatcacccatgaggttatgtgggat
ccacgagaaaacggagggtttgctttcggaaacgagttcagcattgaggttcatatgcga
gactacatgaatattcactgccctcagtatgatcaagatgataaagctaagcttagtttc
atcatctacaatgtcagcgaacaatcatacaacagttgctctctcactgatatgaaaact
gcgatttttaagtgtgacaacccagttaaaggacgcaagctcaccaccaagtttcaacga
agaagtccaaacccactgggattcgtatatcaaccaaataaagattacttctttatggca
ttcaaaaaagatgaacctcagaattgcaaatcagcgatgaaaatgaaagttcatgttctg
ccgaaaagactgcacgaacacgaccggaaaccggtgactgcaggtacaacacggtcgtca
acgccaaggacactttcgtcaaccactaccactacaacaatagcaacaacaacaacaaca
acacctcgaacaagtcagaaaccccatataccaagacagagctcgacaagaaatactccg
cccacaaagacgctcaaacctggatatgtccggggcgacggtgaaggtgacggcccgggt
ggcggggtcggtagaattacttgcgccaccacgtggatgttagttgcgttagtgctgact
gttctgttacaaaactga

DBGET integrated database retrieval system