KEGG   Chryseobacterium indologenes: CEQ15_00580Help
Entry
CEQ15_00580       CDS       T04932                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cio  Chryseobacterium indologenes
Brite
KEGG Orthology (KO) [BR:cio00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CEQ15_00580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ASE60118
UniProt: A0A1Z3VX70
Position
124966..126108
Genome map
AA seq 380 aa AA seqDB search
MEFPILLVVIIALALIFDYINGFHDAANSIATIVSTKVLTPFQAVLWAALWNFAAFFIAA
YIIGEFKIGNTIAKTVNENFITLEVIFSGLVAAIAWNLLTWWFGIPSSSSHTLIGGFLGA
ALMHAFMMDYHEVAAAQPALGFWDTAKEAFNQVTHQSVVKFDKVIPIFLFIFMAPIIGMI
ISIIITLIIVHLYKRSNPHKADKSFKRLQLASSALFSLGHGLNDAQKVMGIIGAAVIYYH
VNMLQDTQYLNIPSAERFDYFAQHYIWVPLVSFIAIALGTMSGGWKIIKTMGTKITKVTS
LEGVSAETAGAITLFITDHFGIPVSTTHTITGSIIGVGLTKRISAVRWGITVSLLWAWVL
TIPISAIVAGVTYLIVTFLF
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggaatttcctattttacttgtagttattattgcgctggcattaatcttcgattacatc
aatggttttcatgatgcagccaactcaattgcaactattgtttctacaaaagttttaact
ccattccaggccgtactatgggcagccctatggaactttgcagcattctttattgctgct
tatattattggagaattcaaaatcggtaatacaattgccaaaacagttaatgagaatttt
atcacccttgaagtcatattttccggtctggtggcagcaattgcctggaacctgttgaca
tggtggttcggaattccttcatcatcctcacatacattgatcggtggattcttgggagca
gcattaatgcatgctttcatgatggattaccatgaggtggcagcagcacagccggctctt
ggtttctgggatacggctaaagaagctttcaaccaggtgactcaccagagtgtcgtgaag
tttgataaagtgattcctatcttcttattcattttcatggctccgattatagggatgatt
atctcaatcatcatcactcttatcattgtacacctttataaaagatcaaaccctcacaaa
gctgataagtccttcaaaagattacagctggcttcttccgctttgtttagcttgggacac
ggtctgaatgatgctcagaaagtaatggggatcattggggcagcggttatttattatcac
gttaatatgcttcaggatacccagtatttgaacatcccttcagcagaacgttttgattac
tttgcccagcactatatttgggttcctctcgtttcatttattgcaatcgctttaggaaca
atgagtggaggatggaaaatcattaaaacaatggggaccaagattactaaagtaacctca
ttggaaggggtaagtgcagaaactgcaggagctatcaccttattcattacagaccatttc
ggtattcctgtatctacaacacatacgattacaggttctattatcggggtaggattgaca
aaaagaatatcggcagtgagatgggggattacagtaagccttctttgggcctgggtactg
acaattccgatttcagctattgtagcgggagttacttatcttattgtaaccttccttttc
taa

DBGET integrated database retrieval system