KEGG   Chryseobacterium indologenes: CEQ15_12770Help
Entry
CEQ15_12770       CDS       T04932                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
cio  Chryseobacterium indologenes
Pathway
cio00860  Porphyrin and chlorophyll metabolism
cio01100  Metabolic pathways
cio01110  Biosynthesis of secondary metabolites
cio01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cio00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CEQ15_12770 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cio01007]
    CEQ15_12770 (hemL)
Enzymes [BR:cio01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     CEQ15_12770 (hemL)
Amino acid related enzymes [BR:cio01007]
 Aminotransferase (transaminase)
  Class III
   CEQ15_12770 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ASE62303
Position
complement(2822045..2823334)
Genome map
AA seq 429 aa AA seqDB search
MKYQRSSALFDEAYKYIPGGVNSPVRAFKSVGGVPVFMKSAKGAYLTDADDNTYIDYINS
WGPAILGHTHPEVLEDLKLQAEKGFSFGAPTELETEIAKFIIENVPNIDQIRMVSSGTEA
CMSAIRLARGYTGRDKIVKFEGCYHGHSDSFLIKAGSGAATFGNPNSPGVTAGTAKDTLL
ARYNDFEQVEDLFRHNAGEIAAVIIEPVAGNMGCVLPENNFLQNLRRICDENGALLIFDE
VMTGFRLAFGGAQELFNVKADLVTYGKVIGGGLPVGAFAGRNEIMDHLAPKGGVYQAGTL
SGNPLAMRAGLKTLQLIKNDPEFFNRLAKTTEMLDFEIGKILNEKGIAHKINRKGSMMSV
FFHTNRVSNFDEAQEANHSLFNNFFHQMLTNGIYLPPSGYETYFISDAIKEKEIDMTLEA
VRKFEYSNK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatcaaagaagttcggctttatttgatgaagcctacaaatacattccgggaggc
gttaactcaccggtgagagcattcaaatctgtgggaggagttcccgttttcatgaaatca
gcaaaaggtgcttaccttactgatgcagatgacaacacctatatcgattacatcaattca
tggggacctgcgattttaggtcatacccatcctgaagtgttggaagatttgaagctacag
gccgaaaaaggattttctttcggtgctcctacagaacttgaaaccgagattgcaaaattc
atcatcgaaaacgttccgaatatcgatcagatcagaatggtttcttcaggaacagaagcc
tgtatgagcgcgatcaggctggcaagaggatatacaggaagagataaaattgtgaaattt
gaagggtgctatcacggacattcagattcattcctgattaaagcgggaagtggagctgca
acttttggtaatcccaattctccgggagtgacagcaggtacggctaaggatactttactg
gctcgttacaacgattttgaacaggtagaagatttgttccgtcataatgcaggagagatt
gccgcagttattattgagccggtggcaggaaatatgggatgtgttttaccggaaaataat
ttccttcagaacctgagaagaatctgtgatgaaaatggtgctttattgattttcgatgag
gtaatgacaggcttcagactcgctttcggaggtgcacaggaacttttcaacgtaaaagct
gatcttgtaacgtacggaaaagttatcggtggaggactgccggtaggagcttttgccgga
agaaatgaaatcatggaccatctggctcccaaaggaggagtatatcaggcaggaacatta
agtggaaatcctttagcgatgagagcaggattgaaaacccttcagctgattaaaaatgat
cctgaatttttcaacagattagccaagacaacagaaatgctggattttgaaatcgggaag
attttaaatgaaaaagggattgcccataagatcaacagaaaaggctctatgatgtctgta
ttcttccataccaacagagtatctaactttgatgaagcacaggaagccaatcactcatta
ttcaataatttcttccaccagatgctgacgaacggaatatatcttccgccaagtggttat
gaaacatatttcatcagtgatgcgatcaaagagaaggaaattgatatgacactggaagca
gtgaggaaatttgaatattcaaataaataa

DBGET integrated database retrieval system