KEGG   Chryseobacterium indologenes: CEQ15_21745Help
Entry
CEQ15_21745       CDS       T04932                                 

Definition
(GenBank) NAD(P)H-dependent oxidoreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
cio  Chryseobacterium indologenes
Pathway
cio00633  Nitrotoluene degradation
cio01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cio00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CEQ15_21745
Enzymes [BR:cio01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     CEQ15_21745
  1.-  
   1.-.-  
    1.-.-.-  
     CEQ15_21745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: ASE63909
UniProt: A0A1Z3W7Z7
Position
complement(4838217..4838816)
Genome map
AA seq 199 aa AA seqDB search
MNFLDQMKKRYTVKKYNPQGVISKEQIHQLKEILNLSPSSINSQPWNFIFVHEPEVKAQL
GEKSYFNKEKVLDSSYIIVFQVIKNIEKFEKQIEENLSEGNITYYKTMVKPKGEAAVKGW
LRHQVYLSLGVFLSACAAMGIDSTPMEGIEPEEYDNILQNIEYETLFAVAIGERHITDAN
QPQFNPKARLQAEKVILEA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaactttttagatcaaatgaaaaaaaggtatactgtaaagaagtataaccctcaggga
gtcatcagcaaggaacaaatccaccagctgaaagaaattcttaaccttagcccttcttcc
atcaatagccagccatggaattttatttttgtacatgaaccggaagtgaaggcgcaattg
ggagaaaaatcttattttaacaaggaaaaggttttggacagcagctatattattgtattc
caggtcataaaaaacattgaaaaatttgaaaaacaaattgaagaaaacctttcggaaggt
aatattacctattacaaaaccatggtgaaaccaaagggtgaagcagccgtaaaaggctgg
ttaaggcatcaggtatatctgtcgctgggagtatttctttctgcctgtgcagcaatggga
atagattctaccccgatggagggaattgaacctgaagaatacgacaacatccttcagaat
attgaatatgaaacactttttgccgtagctatcggtgaaagacatattacagatgcgaac
cagcctcaattcaatcctaaagcaagattgcaggccgagaaagtgattctggaagcataa

DBGET integrated database retrieval system