KEGG   Citrobacter sp. CFNIH10: C2U53_04620Help
Entry
C2U53_04620       CDS       T05324                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
cir  Citrobacter sp. CFNIH10
Brite
KEGG Orthology (KO) [BR:cir00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    C2U53_04620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AUZ63189
UniProt: A0A3Q8D7P6
Position
286456..286833
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCIQVQSVYIEAQSSPEDDRYVFAYTVTIRNLGRAPVQLLGRYWLITNGHGRET
EVQGEGVVGVQPHIEPGEEYQYTSGAVIETPLGTMQGHYEMIDENGVAFTIDIPVFRLAV
STLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattcgccccgagtgtgtattcaggtccaaagcgtctatatcgaggcgcaatcc
tcacctgaagatgaccgttacgtttttgcctacaccgtaaccatccgcaatctggggcga
gcgcccgtgcagctactgggacgctattggttgatcaccaacggtcatggccgagaaact
gaagtccagggagaaggtgtggttggcgttcagccgcacattgagcctggcgaagagtac
cagtacaccagcggcgctgttatcgaaacgccgctgggcacgatgcagggtcattacgaa
atgattgatgagaacggcgtcgcctttaccatcgatattccggttttccgactcgccgtt
tccactctcattcactaa

DBGET integrated database retrieval system