KEGG   Citrobacter sp. CFNIH10: C2U53_11505Help
Entry
C2U53_11505       CDS       T05324                                 

Definition
(GenBank) PTS fructose transporter subunit IIB
  KO
K02813  PTS system, sorbose-specific IIB component [EC:2.7.1.206]
Organism
cir  Citrobacter sp. CFNIH10
Pathway
cir00051  Fructose and mannose metabolism
cir01100  Metabolic pathways
cir02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:cir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    C2U53_11505
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    C2U53_11505
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cir02000]
    C2U53_11505
Enzymes [BR:cir01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     C2U53_11505
Transporters [BR:cir02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    C2U53_11505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb
Motif
Other DBs
NCBI-ProteinID: AUZ64407
UniProt: A0A3S7D607
Position
complement(1687524..1688018)
Genome map
AA seq 164 aa AA seqDB search
MNITLARIDDRLIHGQVTTVWSKVANAQRIIICNDDVYNDEVRRTLLRQAAPPGMKVNVV
NIEKAVAVYHNPQYQDETVFYLFTRPQDALAMVKQGVKIATLNIGGMAWRPGKKQLTKAI
SLDDDDINAFRELDKFGVTLDLRVVASDPSINILEKIKEQSFAE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaatattacccttgcccgtattgatgaccgcttgatccacggtcaggtcaccaccgtc
tggtcgaaggtggcgaatgcccagcggattattatctgtaatgacgacgtttataatgat
gaagtgcgccggacattattacgccaggccgccccaccgggaatgaaggtcaacgtggtg
aatatcgaaaaagccgtcgcggtttatcataatccacagtatcaggacgagactgtattt
tatttatttacccgcccacaggatgcgctggcgatggtcaaacagggcgtaaaaattgcc
accttaaatattggcggcatggcctggcgaccgggtaaaaaacaattaaccaaagccata
tccttagatgacgatgatattaatgcgtttcgcgaactggataaatttggcgtcaccctg
gatttacgcgtggtcgcctccgatccctccattaatattctcgaaaaaataaaagaacag
tcgttcgcggaataa

DBGET integrated database retrieval system