KEGG   Citrobacter sp. CFNIH10: C2U53_14110
Entry
C2U53_14110       CDS       T05324                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
cir  Citrobacter sp. CFNIH10
Pathway
cir00230  Purine metabolism
cir01100  Metabolic pathways
cir01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cir00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    C2U53_14110
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AUZ64880
UniProt: A0A3Q8DSJ9
Position
complement(2205807..2206286)
AA seq 159 aa
MNDTNRITLECVINDHPFQLSIMPGMPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAAGKQIRTLEGESAGSQLSRVQMAYATSGAVQCGFCTPGLIMATTALLAK
PREKPLTILEIRRGLAGNLCRCTGYQMIVDTVQRCTEPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatgacactaaccgaatcacgctggaatgcgtcattaatgatcacccttttcagctc
agcatcatgccggggatgccgctctctgaactcctgcgcgaacaagggttgttgagcgtc
aaacagggatgctgtgtcggtgaatgcggagcctgtacggtgctggttgacggtacagcc
atcgacagttgcctgtaccttgccgcgtgggcagccggaaaacagatccgtaccctggaa
ggtgaatcggctggcagtcagctctcgcgtgttcagatggcttatgcgacatccggtgcc
gtgcagtgtggtttttgcacgccgggtctgattatggcgaccaccgcattgctggcaaaa
ccgcgggaaaaaccattaaccattctggagatccgtcgtggtctggcggggaatttgtgc
cgttgtactggctatcagatgattgtcgataccgtccagcgctgcactgagcctgaataa

DBGET integrated database retrieval system