KEGG   Citrobacter sp. CFNIH10: C2U53_14120
Entry
C2U53_14120       CDS       T05324                                 

Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
cir  Citrobacter sp. CFNIH10
Pathway
cir00230  Purine metabolism
cir01100  Metabolic pathways
cir01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cir00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    C2U53_14120
Enzymes [BR:cir01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     C2U53_14120
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AUZ64882
UniProt: A0A3Q8D741
Position
complement(2207172..2209469)
AA seq 765 aa
MDAREATVTGESCMRVDAIAKVTGRARYTDDYMMAGMCYAKYVRSPIAHGYATSINCDEA
KSLPGVLAVFTWEDVPDIPFATAGHAWTLDENKRDTADRFLLTRHVRHHGDAVAIVVARD
ELTAEKAALLVNVVWEKLPVITTPEAALADDAVPIHPGGNLLNRSEMTTGNVQQAIDAAD
YQLQGHYQTPVIQHCHMESVTSLAWMEDDSRISIVSSTQIPHIVRRVVGQALGIPWSCVR
VIKPYVGGGFGNKQDVLEEPMAAFLTRKLGGIPVKVSLSREECFLASRTRHAFTMDGQIG
LNRDGTLQGYRLDVLSNTGAYASHGHSIASAGGNKVAYLYPRSAYAYRSTTCYTNLPSAG
AMRGYGAPQVIFAVESMLDDAATALGLDPVEVRLRNAACEGDTNPITGKRIYSAGLPECL
QKGRALFEWDARRAECLHQQGNIRRGVGVACFSYTSNTWPVGVEIAGARLLMNQDGTINV
QSGATEIGQGADTVFSQMVAETLGVPVSDVHVISTQDTDITPFDPGAFASRQSYVTAPAL
RKAALQLRDKILLHAADMLHQSVMSLTLTAGHIVLIDRPDSPLLSLKELAMDAFYHPERG
GQLSAECSVKTTTNPPAFGCTFVDLSVDIALCKVTINRILNVHDSGHILNPQLAEGQVHG
GMGMGIGWSLFEEMIIDGESGLVRNPNLLDYKMPTMPDLPQLESAFVETQEPQSAYGHKS
LGEPPIIPVAAAIRNAVKMATGVAIDTLPLTPKRLYAEFHQAGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggatgcgcgggaagcaaccgttaccggagagtcatgcatgcgcgtggatgccatcgct
aaagtgaccgggcgggctcgatatactgatgattacatgatggcgggcatgtgttatgcc
aaatacgttcgcagtccgattgcccacggttacgccaccagcatcaactgtgacgaggcg
aaaagcctgcccggtgtactggccgtgtttacctgggaagatgtaccggatattcccttc
gccacggcagggcacgcctggacgctggatgagaacaaacgtgacaccgccgaccgtttt
ctgttgacccgccacgtacgccatcatggcgatgcggtcgcgattgttgtggcaagggac
gagttaaccgcagaaaaagcggccttgctagtgaatgtggtatgggaaaaactcccggtg
atcaccacgccagaagcggctctggcggatgatgctgtccctattcacccaggcggtaat
ttgctcaatcgcagtgaaatgaccaccgggaatgtccagcaggccattgatgccgctgat
taccaactccagggacattaccagacgccggtgattcaacattgccatatggaaagcgtc
acttcattggcctggatggaagatgactcgcgaatctccatcgtctccagcacgcagatc
ccacacatcgtacgccgggtcgtgggccaggcattgggcattccgtggtcatgcgtgcgg
gttatcaaaccttacgtcggcggcggatttggaaacaagcaggatgtgctggaagaaccc
atggccgctttcctgacgcgcaaactgggcggtattccagtgaaagtctctctcagccgt
gaagagtgttttctcgcttcccgtacccgccatgcgttcacgatggatggacagataggg
ctcaatcgcgacggcacgttgcaaggctatcgtctggatgttctgtcaaatactggcgct
tacgcctcacacgggcactccatcgcctcggcgggcggcaacaaagtggcctatctctat
ccccgtagcgcatacgcttaccgttccaccacctgctataccaatcttccttccgctggc
gcgatgcgcggctacggcgcgccgcaggtgatctttgccgtagaatcgatgctggatgac
gccgcaacggcgctgggtctcgatccggtcgaggttcggttgcgcaatgcggcctgcgaa
ggcgacacgaacccgattaccggcaaacgcatctacagcgcggggctcccggaatgcctg
caaaaaggccgcgcgctgtttgagtgggacgcccgtcgcgctgaatgtctgcaccagcaa
ggcaacatccgccggggcgtcggcgtcgcctgttttagttatacctccaacacctggccg
gtcggcgtggagatcgctggtgcccgtctgctgatgaatcaggacggaacgatcaacgtg
cagagcggagccacggaaatcggtcagggggcggataccgttttctcacagatggtggcg
gaaactctcggcgtaccggtcagcgatgtgcacgttatttccacccaggataccgatatt
acccccttcgaccctggcgccttcgcctctcgccaaagctatgtcaccgcaccggcactg
cgcaaggcagcacttcaactgcgcgataagatccttcttcacgctgccgacatgctgcat
cagtccgtcatgagcctgacgctgacggcaggccacatcgtccttatcgatcgcccggac
tcaccgttgctgtccttaaaagagctggcgatggatgcgttttatcatccggagcgcggc
ggtcagttgtctgcggaatgctcggtgaaaaccaccactaacccaccggcgtttggctgc
acgtttgtcgatctgagcgtcgatatcgccctgtgcaaggtcaccatcaaccgcatcctc
aatgtccacgattccggccatattctgaaccctcaactggcggaaggtcaggtgcatggc
gggatgggaatgggcattggctggtcgctgtttgaagagatgatcatcgatggggaaagt
ggtctggtgcgtaacccgaatctccttgattacaaaatgccgaccatgcctgacctgccg
caactggagagcgcattcgttgaaacgcaggagccgcagtcggcgtatggacataaatcc
ctcggcgagccgcccattattcctgttgctgccgccattcgtaacgcagtgaaaatggcc
acaggcgttgcaattgatacgttgccactgacgccaaaacggttatatgcggagttccac
caggctggcttgatttga

DBGET integrated database retrieval system