KEGG   Citrobacter sp. CFNIH10: C2U53_14845Help
Entry
C2U53_14845       CDS       T05324                                 

Definition
(GenBank) tRNA pseudouridine(65) synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
cir  Citrobacter sp. CFNIH10
Brite
KEGG Orthology (KO) [BR:cir00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cir03016]
    C2U53_14845
Enzymes [BR:cir01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     C2U53_14845
Transfer RNA biogenesis [BR:cir03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    C2U53_14845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AUZ65006
UniProt: A0A3Q8D8U2
Position
2353592..2354386
Genome map
AA seq 264 aa AA seqDB search
MLEILYQDEWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRRLAQQFEQHQIHKRYHAIVRGWLMEEAVLDYPLVEELDKIADKFARENK
DPQPAVTHYRGLATVEMPVATRRYPTTRYGLVELDPQTGRKHQLRRHLAHLRHPIIGDSK
HGDLRQNRSAAEHFGCNRLMLHASQLSLTHPFTGEPLTIHAGLDTVWMQALSQFGWQGLL
PNNERVELSEPAGQDERIRSSFRE
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaattctgtatcaggatgaatggctggttgcggtcaacaagccttccggctgg
ctggtgcaccgcagctggctggatcgagacgaaaaagtggtggtgatgcagaccgtgcgt
gaccagattggtcagcatgtgtttaccgcgcatcgcctcgacagaccaacatccggcgtc
ctgctgatgggcttatccagtgaagccggacgccgtctcgcgcagcagtttgagcaacac
cagatccataagcgctatcacgccattgtccgtggttggttaatggaagaggcggtactc
gattatccgctggtggaggaactggataaaatcgccgacaagtttgcccgcgaaaacaaa
gacccacagcctgcggtaactcattaccgtggcctcgccaccgttgaaatgcccgtggca
accaggcgttatccgacgactcgttacggactggtggaactggatccgcaaacgggacgc
aagcatcagctcagacgtcatctggcgcacctgcgccatccgattattggcgacagcaag
catggcgatttgcggcagaaccgcagtgcagcggaacattttggctgcaaccgactgatg
ctgcatgccagccagctttcgctgactcatccgtttaccggtgaaccgttgacgattcat
gccgggctggatacggtctggatgcaggcgctatcacagtttggctggcagggccttctc
cctaataatgaaagggttgagttaagtgagccagcaggtcaggatgaacgcatacgttct
tcattcagggagtaa

DBGET integrated database retrieval system