KEGG   Citrobacter sp. CFNIH10: C2U53_15300Help
Entry
C2U53_15300       CDS       T05324                                 

Definition
(GenBank) MASE1 sensor histidine kinase
  KO
K20263  two-component system, NarL family, sensor histidine kinase FusK [EC:2.7.13.3]
Organism
cir  Citrobacter sp. CFNIH10
Pathway
cir02020  Two-component system
cir02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cir00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C2U53_15300
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    C2U53_15300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cir01001]
    C2U53_15300
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cir02022]
    C2U53_15300
Enzymes [BR:cir01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     C2U53_15300
Protein kinases [BR:cir01001]
 Histidine kinases
  NarL family
   C2U53_15300
Two-component system [BR:cir02022]
 NarL family
  FusK-FusR (virulence regulation)
   C2U53_15300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MASE1 HisKA_3 HATPase_c HATPase_c_3 ApbE Ufd2P_core HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: AUZ65087
UniProt: A0A3Q8DI85
Position
complement(2466697..2468238)
Genome map
AA seq 513 aa AA seqDB search
MSHNLRHVVISLFIVLAWGTGWLMLWTLGFYLTHNGQQAALFLPHGVYLALLILLSRRYW
PALVLPPMMMMFWLHSEQLLNGYILLTTPLISMIPASLAQTFWYRFPLYWQRLTLLLATV
TAASLLNAALLSPFVKSPAMLLGLASFTGGVLLTPFVYLIFEFLRQQHRYHLLGLDTNNP
PLRTSLIIWCSLFFIIGIGTQMVLSPEIERLLLIVVFLPNVVMAWKFGWQGGVLSGLLGS
MMITIARQIGVGFSNLIELEIFLATQSLLGIGLGIAISRQQHLAQNLHHYRRRLEAELAA
RRALAEKLVHTEEDTRKSLARELHDEIGQNITAIQIQSQLVKRAHDPAQAQAAASQINDL
ARRIHHSTRQLLRQLRPPALDELSFKEALLHLLNEFAFTERGIHCQFDYQLTATPENETV
RFTLYRLLQELLNNICKHAGASEVRIVLRQQGDMLHLDVSDNGVGISADKIAGFGIQGMR
ERVSALGGELALESRHGTRVSVNLPTNLQQIAF
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacaacctccgtcacgtcgtcatttcactgtttattgtgctggcctggggcacc
ggctggctgatgctgtggacgcttggtttttatctgacccacaacggccagcaggcggcc
ctgttcctgccgcacggcgtctacctggcgctgctgatcctgctttcacgccgctactgg
cccgcgctggtgctgccaccgatgatgatgatgttctggctgcacagcgagcaactgctc
aatggttatattctgctgaccacaccgcttatcagcatgattcccgccagcctcgcacag
actttctggtaccgtttccctctttactggcagcggctgacgctgctgctggccacggta
acagccgcctcattgctcaacgccgctctactgtcgccgtttgtcaaaagtccggcgatg
ctgctcgggctggcgtcgtttaccggtggcgtgctactgacgccgttcgtttatctgatc
ttcgagtttctgcgccagcagcatcgctaccacctgctgggtctggacaccaataacccg
ccgctgcgtacctcgctcatcatctggtgcagcctgttttttatcattggcattggcacc
cagatggtgctgtcgccagagattgaacgcctgctgttgattgtggtgtttctgcccaac
gtggtgatggcgtggaaattcggctggcagggtggcgtgctctcggggctactcggcagc
atgatgatcaccatcgcccgccagattggcgtgggcttcagcaatctgattgaactggag
atttttctcgcgacacagtcactgctcggtattggtctggggatcgccatcagtcgtcag
cagcatctggcgcaaaacctgcaccattatcgccggcgtctggaagctgaactggcggcg
cggcgcgcgctggccgaaaaactggtgcataccgaagaggatacgcgcaagagcctggcg
cgcgaactgcatgacgagattgggcaaaacatcaccgccattcagatccagtcgcaactg
gtaaaacgggcgcacgatccggcgcaagcccaggccgccgccagccagatcaacgatctc
gcccggcgaatccatcactccacccgccagttgttgcgccagcttcgcccacccgcgctg
gacgaactgtcgttcaaagaggcgctgctccacctgctcaacgagtttgcctttacggaa
cgcggcattcactgccagtttgactatcagcttaccgccacgcccgagaatgaaacggtg
cgcttcactctctatcgactgttacaggagttgctcaacaacatctgtaaacacgccggg
gccagcgaagtacgaattgttctgcgtcagcagggagatatgctgcatctggacgtgtcc
gacaacggcgtggggatcagtgcagacaagatagccggttttggcattcagggaatgcgc
gagcgggtcagcgccctcgggggtgaactggcgctggaatcgcggcacggtacgcgggta
agtgttaacttgcccacaaatttgcaacaaatcgccttctga

DBGET integrated database retrieval system