KEGG   Citrobacter sp. CFNIH10: C2U53_21170Help
Entry
C2U53_21170       CDS       T05324                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cir  Citrobacter sp. CFNIH10
Pathway
cir00480  Glutathione metabolism
cir00590  Arachidonic acid metabolism
cir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cir00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    C2U53_21170
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C2U53_21170
Enzymes [BR:cir01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     C2U53_21170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin
Motif
Other DBs
NCBI-ProteinID: AUZ66131
UniProt: A0A3S7DB52
Position
3593469..3594020
Genome map
AA seq 183 aa AA seqDB search
MQDSILNTVVTTIDGEVTTLEKYTGNVLLIVNVASKCGLTPQYEQLENIQKAWADRGFIV
LGFPCNQFLGQEPGSDDEIKTWCATTWGVTFPMFSKIEVNGEGRHPLYQKLIEAAPTAVA
PEESGFYERMASKGRAPLYPDDILWNFEKFLVGRDGKVIQRFSPDMTPEDPIVMESIKLA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaagactcgattctgaacacggtagtgacaacgattgatggcgaagtgaccacgctt
gagaaatacacaggtaatgttctgctgattgttaacgtagcttcaaaatgcggacttacc
ccacagtatgagcaactggaaaatattcagaaagcgtgggccgaccgtggctttattgtg
ctgggctttccctgcaatcagttccttgggcaggaacctggcagtgatgacgagatcaaa
acctggtgcgcgacgacctggggcgtgaccttcccgatgttcagcaagattgaggtaaac
ggggaggggcgtcatccgctgtaccagaaactgattgaggcggcaccgacggctgtagcc
cctgaagagagtggtttctatgagcgaatggccagcaaagggcgtgcgccgctctatcct
gacgatatcctgtggaactttgagaagttcctcgtaggccgtgatggcaaagtgatacag
cgtttctctccggatatgacgccggaagatccgattgtgatggaaagcatcaaactcgcg
ttggctaaataa

DBGET integrated database retrieval system