KEGG   Citrobacter sp. CFNIH10: C2U53_28235Help
Entry
C2U53_28235       CDS       T05324                                 

Definition
(GenBank) indolepyruvate decarboxylase
  KO
K04103  indolepyruvate decarboxylase [EC:4.1.1.74]
Organism
cir  Citrobacter sp. CFNIH10
Pathway
cir00380  Tryptophan metabolism
cir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cir00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    C2U53_28235
Enzymes [BR:cir01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.74  indolepyruvate decarboxylase
     C2U53_28235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M XFP_N
Motif
Other DBs
NCBI-ProteinID: AUZ67403
UniProt: A0A3S7DER0
Position
complement(4928902..4930557)
Genome map
AA seq 551 aa AA seqDB search
MQTPYTVADYLLDRIAGCGIGHLFGVPGDYNLQFLDHVIDHPHVRWVGCANELNAAYAAD
GYARVAGSGALLTTFGVGELSAMNGLAGSYAEYVPVLHIVGAPCSGAQRRGELMHHTLGD
GDFQHFYRMSQSLCAASAVLDAQNACHEIDRVLSTMLTAHRPGYLMLPADVAKRPALPPS
AELILSAPESQGSVVTAFRYHARQKLINSPRVALLADFLAHRFGLQPVLQRWMAETPIAH
ATLLMGKGLFDEQQPGFVGTYSAGASSDDVRQAIEEADTTICVGTRFVDTLTAGFTQQLA
LERTIEVQPQASRVGGIWFSGLSMEQAVTTLRELCLELSIAPPPVKPATVQLHIERGPLT
QENFWHTVQQALAPGDLILADQGTAAFGAASLLLPTGAELIVQPLWGSIGYSLPAAFGAQ
TAAPERRVILITGDGAAQLTIQEIGSMLRDGQTPVILVLNNDGYTVERAIHGEKQRYNDI
ASWNWTQIPRAFSLADQAECWRVTQAIQLEEVLARLARPQRLSLIEVVLPKADLPVLLRK
VTQALESRNSG
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccccttacaccgttgcggattacctgctcgacagaattgccgggtgcggcatc
gggcatctgtttggcgtgccgggtgattacaatttgcagtttcttgaccatgtgatcgac
catccacatgtgcgctgggtcgggtgtgccaacgagcttaacgctgcctatgcggcggac
ggttatgccagggtcgccgggtccggagcgctgctgactacctttggagtcggggaactc
agtgcgatgaatggcctggcgggcagctatgcggaatatgtccccgttctgcatattgtt
ggcgccccatgtagcggcgcgcagcgtcggggagaactgatgcaccacacgctgggcgac
ggcgatttccaacacttctaccggatgagccagtccctgtgtgcggccagcgctgtgttg
gatgcgcaaaacgcctgtcatgaaattgaccgtgtactgagtacgatgttgaccgcccat
cgcccgggttacctgatgctgcctgctgacgtggcgaaacgtcccgcgttgcctccttca
gcggaactgatcctctctgcaccggaatcgcaggggagcgtggtgacggcatttcgctat
catgcccgacaaaagctgatcaacagtccccgcgtggcgctgctggccgattttctcgcc
caccgttttggtctacaaccggtcctgcaacgctggatggccgagacgcctatcgcccac
gccacgctgttgatgggaaaaggacttttcgatgaacaacagccgggatttgtcggcacc
tatagcgcgggggccagcagtgacgacgtccgtcaggcgatagaagaggcggatacgacg
atttgtgtgggtacccgattcgtcgatacgctaacggctggcttcacccagcaactggcg
ctggaacgcacaattgaggtgcagccgcaggcatcgcgggtgggaggcatctggttcagt
ggactgtctatggagcaggcggttaccacgttacgtgagctatgcctggaactctccatt
gcgccgccgcccgttaaacctgcgaccgtacagctgcacatcgaacgaggtccactgacc
caggagaacttctggcataccgtgcagcaggcgctggcacccggcgatctgatcctggcc
gatcagggaacggcggcatttggggccgcgtccctgttgttgcctacgggggcggaactg
attgtccaaccgctctggggatcgataggctattcgctgcccgccgcgtttggcgcgcaa
acggcggcgcctgagcgtcgggttatcctgataaccggcgacggcgcggcgcaactgacc
atccaggaaatcggctccatgttgcgcgacgggcaaacgccggtaattctggtactcaac
aacgacggctacaccgtcgagcgagctatccacggggagaaacaacggtacaacgatatt
gcttcctggaactggacgcagatccctcgggcattcagccttgcggatcaggctgaatgc
tggcgggtgactcaggccatccagctcgaggaagttctggcccggctggcacgtccacaa
cggctctcgctgattgaggtcgtgctgccaaaagccgatttacccgtgctgttacgtaag
gtcactcaggcgctggagtcgcgtaacagcgggtga

DBGET integrated database retrieval system