KEGG   Citrobacter sp. CFNIH10: C2U53_28465Help
Entry
C2U53_28465       CDS       T05324                                 

Definition
(GenBank) GMP synthase
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
cir  Citrobacter sp. CFNIH10
Pathway
cir00230  Purine metabolism
cir01100  Metabolic pathways
Module
cir_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cir00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    C2U53_28465
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cir01002]
    C2U53_28465
Enzymes [BR:cir01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     C2U53_28465
Peptidases [BR:cir01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   C2U53_28465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase DJ-1_PfpI Peptidase_C26 GATase_3
Motif
Other DBs
NCBI-ProteinID: AUZ67441
UniProt: A0A3S7DEV6
Position
4974340..4975056
Genome map
AA seq 238 aa AA seqDB search
MHVHFIIHESFESAGAYLPWAETRGHHITWTRVYDSEPVPANADGFDMLVVFGGPQSPRT
TLAECPYFDSKAEQHLINQAISAGRIVVGICLGSQLIGEALGARVCQSPEKEIGHYPITL
TEAGKQHPLLVHFGSPLTVGHWHNDMPGLTDQATVLATSIGCPRQIVQYGNFVYGFQCHM
EFTAEAVEGLIQHSEQELAEAKGKRFIRSKAEMREWDYKEMNEKLWQFLDLLVKKRQG
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgtccattttattattcacgaatcatttgaatcggcaggcgcttatttgccgtgg
gctgaaacgcgcggtcatcacatcacctggacccgcgtctatgacagcgaaccggttccg
gccaacgccgatggctttgatatgctggtcgtgtttggcggcccgcagtcaccgcgcacc
acgctagcagagtgcccttattttgactctaaggctgaacaacacctgatcaaccaggct
atctcggcgggtcggatcgtggtcgggatctgtctgggttcacagttgattggcgaagcg
ctgggagccagggtctgccagagtccggaaaaagagattggtcactatcccattacgctg
accgaagcaggaaaacagcatccgttgcttgtccacttcggctctccgctgacggtcggc
cactggcataacgacatgccagggcttaccgatcaggccacggtgcttgccacaagcatc
ggctgtccacgacagatcgtgcaatacggcaactttgtctacggcttccagtgccatatg
gaatttactgccgaggcggtggaaggactgattcaacattctgagcaagagctggcggaa
gccaaagggaagcgctttattcgctcgaaggcggaaatgcgcgaatgggattataaggaa
atgaatgaaaaactctggcagttcctggatctgctggtgaaaaaacgtcagggttaa

DBGET integrated database retrieval system