KEGG   Campylobacter insulaenigrae: CINS_0926Help
Entry
CINS_0926         CDS       T03555                                 

Gene name
proC
Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
cis  Campylobacter insulaenigrae
Pathway
cis00330  Arginine and proline metabolism
cis01100  Metabolic pathways
cis01110  Biosynthesis of secondary metabolites
cis01130  Biosynthesis of antibiotics
cis01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cis00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CINS_0926 (proC)
Enzymes [BR:cis01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     CINS_0926 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AJC87889
UniProt: A0A0A8H4R0
Position
complement(879520..880221)
Genome map
AA seq 233 aa AA seqDB search
MASALAKGLCDNYEVTIVARDITKNIISCSNIKIISYDEFNLEDKNIILAFKPYALDEVA
SKLSGKAKWIISVLANTSFEKLHIIQAQNYVKIMPNIAAKFKASATPYLMEKLLFNDEIL
ALLNTFGKAFLLQNEKEFDIAMVLSGCAPAFLSLVAESLANAGVRNGLNNTLSYELTRST
FESFSVLFNKEHPALIKEKICSPAGVTIKGIEALEKKAVRAAFFEAFLASMNK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtgctttagcgaaaggattatgtgataattatgaggttactattgttgcaaga
gatattactaaaaatatcatatcgtgttcgaatattaaaatcatttcttatgatgaattt
aatttagaagataaaaatataattttagcttttaaaccttatgctttagatgaggtagct
agtaagttatcaggaaaggcaaaatggataatttccgttttagcaaacacttcttttgaa
aaactccatattatacaagcacaaaattatgtaaaaataatgcccaatattgcagcaaag
tttaaagcttcagcaactccatatttgatggaaaagctattatttaatgatgaaatttta
gcattgttaaatacctttggtaaagcttttttacttcaaaatgaaaaagaatttgatata
gcaatggttctaagtggttgtgcgccggcatttttgtctttagtagcagaatcattagct
aatgctggagtgaggaatggattgaataatactttaagttatgaattaactagatcgact
tttgaaagttttagtgtattatttaataaagaacatcctgcattaattaaggaaaagatt
tgctctcctgcaggagtgacaataaaaggaatagaagctttagaaaaaaaagctgtaaga
gctgcattttttgaagcatttttggcaagtatgaataaatga

DBGET integrated database retrieval system