KEGG   Citrus sinensis (Valencia orange): 102578064Help
Entry
102578064         CDS       T02983                                 

Gene name
NCED
Definition
(RefSeq) putative 9-cis-epoxycarotenoid dioxygenase 3
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00906  Carotenoid biosynthesis
cit01100  Metabolic pathways
cit01110  Biosynthesis of secondary metabolites
Module
cit_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    102578064 (NCED)
Enzymes [BR:cit01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     102578064 (NCED)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 102578064
NCBI-ProteinID: NP_001275864
UniProt: G8IJA2
Position
5
AA seq 606 aa AA seqDB search
MAAATTTSSLIDLGSCKDSCSSPSFSSSRARIAFSLKKPTEITCSLQTPSILHFPKQSPK
YPPSPAASPPPSSPPLTTKQQPKENDNFAPSKWNFLQKAAALALDAVENALVSQERQHPL
PKTADPTVQIAGNFSPVPEKPVCQNLPTTGKVPDCIQGVYVRNGANPLHEPVAGHHFFDG
DGMVHAVQFNKGSVSYSCRFTETNRFVQERSLGRPVFPKAIGELHGHTGIARLLLFYSRA
LFGLVDPSHGTGVANAGLVYFNNRLLAMSEDDLPYHVRVTPSGDLKTVGRFDFSGQLKST
MIAHPKVDPVTGDLFALSYDVVKKPYLKYFRFSPQGIKSPDVEIPLEEPTMMHDFAITEN
FVVVPDQQVVFKLNEMIRGGSPVIYDKNKVSRFGILDKNATDASKMKWIDAPDCFCFHLW
NAWEEPERDEVVVIGSCMTPADSIFNECDESLKSVLSEIRLNLKTGESTRRPLISEDEQV
NLEAGMVNRNLLGRKTRFAYLALAEPWPKVSGFAKVDLLTGQVNKFIYGGQRYGGEPLFF
PRDPNSENEDDGYILAFVHDEKEWKSELQIVNAMTLELEATVKLPSQVPYGFHGTFISAK
DLAKQA
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagcaactactacttcttcactcatagacttgggctcttgtaaagattcttgt
tcttctccgtctttttcttcttcaagagcaagaattgcttttagtttaaaaaagcccacc
gaaatcacttgctctcttcaaacaccttccattcttcatttccccaagcagtccccaaaa
taccctccatcacctgcagcttcccctcctccatcttctcctcctcttacaactaagcag
caacccaaggaaaatgacaatttcgccccttcaaaatggaacttcttacaaaaagcagca
gctttagccttggacgcagtcgaaaacgcattggtttctcaagagcgtcagcatcctctc
cccaaaacagccgaccccaccgtccaaatcgccggaaacttctctccggtgcccgaaaaa
cccgtctgccagaaccttcccactaccggaaaggtccccgactgcattcaaggcgtctac
gtcagaaacggagccaacccacttcacgaaccggtcgccggccaccatttcttcgacgga
gacggcatggttcatgcagtccaattcaacaaaggctctgtcagctattcttgtcgtttc
actgaaacaaaccgttttgttcaagaacgtagcttaggccgccccgtattccccaaagcc
attggcgagcttcacggccacacgggcatcgcaagattgcttctcttctacagcagagcg
ctcttcggtctcgttgaccccagccacggcactggcgttgccaacgccggccttgtttac
ttcaacaaccgtttgttggccatgtctgaagatgacttgccttatcacgtgcgcgtcact
ccatccggcgacctcaaaacggtcggccgtttcgacttcagcggccagctcaagtccacg
atgatagctcatccgaaagttgatcccgtgacgggtgatttgtttgctctgagttatgac
gttgtcaagaagccttacttgaagtactttcggttttcgccccaagggatcaagtctccg
gacgttgagattccccttgaggagcctacaatgatgcatgatttcgcaatcactgagaat
tttgttgtggtgcctgaccagcaagtggtgttcaagttgaatgagatgatccgaggtggc
tccccggtgatttatgacaagaacaaggtgtcaagatttgggattttggacaagaatgcc
accgatgcttccaaaatgaagtggattgacgcccctgattgcttctgtttccatctttgg
aatgcttgggaagagcctgagagggatgaagttgttgtaattgggtcctgtatgactcct
gccgactccattttcaacgaatgtgatgagagtctgaagagtgttttgtccgaaattaga
ctcaatctaaagaccggcgagtccactcgccgcccccttatctccgaggatgagcaagtg
aacttggaagccggaatggtgaacagaaacttgctcggaagaaagacccgtttcgcgtac
ttagccctcgccgagccatggcctaaagtttcaggttttgccaaagttgatctcttaacc
ggacaagtaaacaagtttatttatggaggtcaaaggtacggtggcgagcctttgttcttt
ccgagagaccccaattcggagaatgaggatgatggctacattctcgcttttgtacatgat
gaaaaggagtggaaatcagagctgcaaattgttaacgcaatgactctggagcttgaagct
acagttaagcttccatctcaagttccttatggcttccacgggacgttcataagcgcgaaa
gatttggccaagcaggcctaa

DBGET integrated database retrieval system