KEGG   Citrus sinensis (Valencia orange): 102606814Help
Entry
102606814         CDS       T02983                                 

Definition
(RefSeq) uncharacterized protein LOC102606814
  KO
K02890  large subunit ribosomal protein L22
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cit00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    102606814
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cit03011]
    102606814
Ribosome [BR:cit03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    102606814
  Bacteria
    102606814
  Archaea
    102606814
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 102606814
NCBI-ProteinID: XP_024947977
Position
9
AA seq 201 aa AA seqDB search
MMISSTTRILLPSPPPTCLATRQLGHNPLILRRDQAGFTSRTDFSRKLSHTHNEIFNSKK
IISSAQKRGISPPNNRNKTNKKAEVSASARYLHMSAHKVRRVIDQIRGRSYEETLMILEL
MPYRACYPIFKLIYSAAANGVHNMGFNEASLVIVKAEVNEASSAKRPRPKAQGRVHMIKR
PTCHITVVLRDMSLDDEYAVS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatgatatccagcacgactcgtatcctcctcccctctccgccgccaacatgtttggcc
accaggcaactgggtcacaacccattaattctccgccgggatcaggctggttttacttca
agaacagatttttctcgcaaactttctcacacccacaatgaaatttttaattccaagaaa
ataatcagcagtgcccaaaagagaggaatatcgccgccgaacaacagaaacaagaccaac
aagaaggcagaagtgtctgcttcagctcgatatctgcacatgtctgctcacaaagtccga
agggtaattgatcagattcgcggacgttcttacgaggagacgcttatgatactggagctc
atgccttatcgggcctgttatcccattttcaaactgatttattctgcggcggcaaatggt
gttcacaatatgggcttcaacgaggccagtttagtcatcgtcaaagcggaagtgaacgag
gcttcttctgctaaaagaccgagacctaaagctcaagggagggttcatatgatcaaaaga
cccacttgtcatatcactgttgtgttaagagacatgtctttagatgatgaatatgcggtt
tcctaa

DBGET integrated database retrieval system