KEGG   Citrus sinensis (Valencia orange): 102606898Help
Entry
102606898         CDS       T02983                                 

Definition
(RefSeq) polyamine oxidase-like
  KO
K13366  polyamine oxidase [EC:1.5.3.14 1.5.3.16 1.5.3.-]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00330  Arginine and proline metabolism
cit00410  beta-Alanine metabolism
cit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    102606898
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102606898
Enzymes [BR:cit01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.14  polyamine oxidase (propane-1,3-diamine-forming)
     102606898
    1.5.3.16  spermine oxidase
     102606898
    1.5.3.-  
     102606898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_3 Pyr_redox_2 HI0933_like FAD_binding_2 FAD_binding_3 DAO Thi4 FAD_oxidored GIDA Pyr_redox DUF3810 TrkA_N
Motif
Other DBs
NCBI-GeneID: 102606898
NCBI-ProteinID: XP_006485563
Position
7
AA seq 487 aa AA seqDB search
MKVSCSVVVFALVFHFFLVTGSRSPPPSDSIIIIGAGMSGIMAAKTLEEAGYKDYIILEA
DSRIGGRVHKGQVDGNTVEMGANWLFSGGPKSSPAHEIAKKIMLRTLYSDYGNLSSNIYK
QGGGLYEKHVVESSFKVADARQEFGINLSKILSSKQGRDEDISILGSQRLFKQVPKGPLD
MAVDYFYNDFEEAEPTRISSLKNTFPRQLMEDFGEDSYFVADPRGFETVVHYIANQFLSH
NNNKITDPRLKLKKTVRKIYQSKNKVIITTEDGSVYHANYVIVTVSVGVLQSDLIEFVPR
LPLWKKLAINNFDMAIYTKIFMKFPCKFWPTGPGTEFFLYAHETRGYFTIWQHLENELPG
ENMIFVTVTDEESRRIEQQSEKKTKAEIMQVLKKMFGNGKQIPEPDTMLIPKWWSNRLYK
GSYSNWPNGYTLHSYHDLQQPFDRLYFAGEHTNSTYLGYVDGAYFSGINTANALIKCLKH
FCEGRRS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtttcatgctctgttgtggtgtttgctctagtgtttcattttttcttagtcaca
ggttcccggtcaccgccaccgtcggattcgataatcatcatcggcgcgggaatgtcagga
attatggcagcaaagacacttgaagaagctggatacaaagattacataatattggaagca
gactccaggattggtggcagggttcacaaagggcaggttgatggaaacacggtggaaatg
ggtgccaactggctttttagtggaggtccaaagtctagtcctgcacatgaaattgctaag
aagattatgctgaggacactctactcagactatggaaacctctcttcaaatatctacaaa
caagggggtggattatacgagaagcatgttgttgaatcttcttttaaagttgcagatgca
agacaggaatttggcataaacctatcaaaaatcttatcttctaaacaaggacgggacgag
gacatctcaattttgggatcacaacgccttttcaaacaggttccgaagggtccacttgac
atggctgttgattacttttataatgattttgaagaggcagagccaactagaatttcaagt
ttgaagaatacatttcctcggcagctcatggaggattttggggaagattcttactttgtt
gctgatcctagaggcttcgaaactgttgtccattacattgccaaccagtttctttctcat
aataacaataagattacggatcccagactcaagctaaagaagacagtgagaaagatctat
cagtcaaagaataaagtaataattacaacagaagacggctctgtatatcatgcaaactat
gtcattgttaccgtcagtgttggagtacttcaaagtgatctcatcgaattcgtcccacgt
ttgccgctatggaaaaaactggcgatcaacaacttcgacatggcaatttatacgaagata
tttatgaaattcccatgcaaattctggccgacgggccctggaactgagttcttcctttat
gcccatgaaacacgtggttattttacaatttggcagcatttggagaatgaactgccagga
gaaaacatgatatttgtgacggtaacagatgaagaatcaaggaggatagagcaacaatca
gaaaaaaagacaaaggctgagattatgcaggtccttaagaaaatgtttggtaatgggaaa
caaattcccgagccagacacaatgcttattccaaaatggtggtccaataggttgtacaag
gggagctactcaaattggcccaacggttatactcttcatagctatcatgatttacagcaa
ccatttgatagactttacttcgcaggggagcatactaattctacatatttaggatatgta
gatggtgcttatttttcaggtattaatactgcaaatgctttgatcaagtgcctcaaacac
ttttgtgaaggacgtcgaagctaa

DBGET integrated database retrieval system