KEGG   Citrus sinensis (Valencia orange): 102607021Help
Entry
102607021         CDS       T02983                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00350  Tyrosine metabolism
cit00360  Phenylalanine metabolism
cit00380  Tryptophan metabolism
cit00950  Isoquinoline alkaloid biosynthesis
cit00965  Betalain biosynthesis
cit01100  Metabolic pathways
cit01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    102607021
   00360 Phenylalanine metabolism
    102607021
   00380 Tryptophan metabolism
    102607021
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    102607021
   00950 Isoquinoline alkaloid biosynthesis
    102607021
   00965 Betalain biosynthesis
    102607021
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cit04147]
    102607021
Enzymes [BR:cit01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     102607021
    4.1.1.105  L-tryptophan decarboxylase
     102607021
Exosome [BR:cit04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102607021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_5 baeRF_family3
Motif
Other DBs
NCBI-GeneID: 102607021
NCBI-ProteinID: XP_006469815
Position
2
AA seq 499 aa AA seqDB search
MGSLDSNMAESVQFKPLDAQEFRKQAHQMVDFIADYYQNIESYPVLTQVEPGFLRSALPD
SAPHRPESFETILKDVQEKIIPGITHWLSPNFFAFFPATVSTAGFLGEMLCACFNSVGFN
WLASPASTELEIVVMDWLATMLKLPKTFMFSGTGGGVIQNTTSDSILVTLIAARDRALDA
VGAENMHKLVVYGSDQTHSTFAKVCKLAGVSPANIRALPTSVDANFSLSPQLLRRAVEAD
VEAGLVPLFLCATVGTTSTTAVDNVEPLAEVANEYGIWVHVDAAYAGSACICPEFRHYLN
GIERVDSFSFSPHKWLLSYLDCCCLWVKQPGLLVKALSTDPEYLKNKPSESNSVVDFKDW
QVGTGRRFKSLRLWMVLRSYGVFNLQSHIRSDIRLAKMFEGFVKSDPRFEIVVPRHFALV
CFRLNPYPHSGSADTEMLNRKLLDWVNSTGRVYLTHTIVGGLYMLRFAVGASLTDERHVV
AAWELIMEGADRLFKGSAF
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgggtagccttgattcaaacatggcggagtctgtccagttcaagcctttagatgctcaa
gaattcagaaaacaagcacaccaaatggttgatttcattgctgactattaccaaaacatt
gaatcatacccggttctcacccaagtcgaacccgggttcctccgttctgccttacccgac
tccgccccgcaccgccccgaatcatttgaaacgatcctgaaagacgttcaggaaaagata
atcccgggtatcactcattggctgagcccaaacttctttgcattctttcccgccaccgtg
agcacggcgggttttctcggagaaatgctgtgcgcttgctttaactcagttggcttcaac
tggcttgcctccccggcttccactgagctcgagattgttgtcatggactggcttgccacc
atgctcaagctacccaaaaccttcatgttttcaggcaccggtggtggcgttattcaaaac
accaccagcgactccattctcgtcaccctcattgcggccagagaccgagctcttgacgcc
gttggtgctgaaaacatgcacaagcttgtcgtttatggctccgatcaaacccattctacc
ttcgctaaagtttgtaaattagccggcgtttctccagccaacatacgcgcccttcccact
agcgttgatgcaaatttttctctgtctcctcaacttctccgtagggctgtggaggctgac
gtggaggccgggctggtcccacttttcctttgtgcaactgtggggaccacgtcaaccaca
gctgttgacaatgttgagccgcttgctgaggtggccaacgagtacggcatttgggtccac
gtggacgctgcctatgctggcagcgcatgtatttgtcccgagtttaggcactacttgaat
ggcattgaaagagtcgactccttcagcttcagtccgcataagtggctgctcagttacttg
gactgttgctgcttgtgggtcaaacaaccgggtctactagtcaaagctctgagtactgac
ccggagtacttgaaaaataaaccgagtgagtcgaattcggttgtggattttaaagactgg
caagttggtacgggtcgaagattcaagtcgctcaggctatggatggtcctacgcagctac
ggtgtgttcaacctccaaagtcacatccggtctgacataaggctggccaaaatgtttgag
gggtttgtaaagtcggacccccgattcgaaatcgtggttcccagacactttgctctggtg
tgtttccggttaaacccgtatccgcattctggttcggctgacaccgagatgttgaaccgg
aaattacttgactgggtcaactcaacggggcgggtttatctgacccacactatagtgggt
gggttatacatgctgaggtttgcagtgggcgcttctctcacagatgagcgccacgtggtg
gccgcgtgggagttaattatggagggggctgataggttgtttaaaggctccgctttctag

DBGET integrated database retrieval system