KEGG   Citrus sinensis (Valencia orange): 102607192Help
Entry
102607192         CDS       T02983                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH11, chloroplastic-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cit00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    102607192
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cit03041]
    102607192
Enzymes [BR:cit01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     102607192
Spliceosome [BR:cit03041]
 Complex C
  Other components
   Step II factors
    102607192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C OB_NTP_bind HA2 IBR AAA_22 DEAD zf-RING_UBOX zf-C3HC4_2 zf-C3HC4 Helicase_RecD ABC_tran AAA_30
Motif
Other DBs
NCBI-GeneID: 102607192
NCBI-ProteinID: XP_006465847
Position
1
AA seq 1730 aa AA seqDB search
MKKSFRHSPARKSLPNSTHYHQHNRPKIPPNQKRHSPSATSPPLPRPNFIIQLRSSTPAI
SGQELKALLSKLSLSCEDVAVSPSGPLIASLYFNQWVDTLNAMVGLWESRLNGAHCLNLK
LIPHVVVPSDADELEERLRNLFVDHVKGLMEGELVNKWLKMKDDKCDEISNVSNRLGSRN
SYAVFCELNERKKGLFKEREMIMRRVREFKNAMHCVLKYLDDPQNVAKKESYDANVDVFR
FEDCQRFDWFRIQAFIVRECKRLEDGLPIYMYRQDILRRIYGEQILVLIGETGCGKSTQL
VQFLADSGIAAEQSIVCTQPRKIAAISLAQRVREESRGCYEDDSVICYPSFSSAQHFDSK
VIYMTDHCLLQHFMNDRDLSRISCIIVDEAHERSLNTDLLLALVKDLLCRRFDLRLVIMS
ATADAHQLSKYFYDCGISHVVGRNFPVDVRYVPCATAGTSAVASYVSDVVRMVGEVHTTE
KEGTILAFLTSKMEVEWACEKFDAPSAVALPFHGQLSFDEQFCVFKSYPGRRKVIFATNV
AETSLTIPGVKFVIDSGMVKESYFEPGTGMNVLRVCRVSQSSANQRAGRAGRTEPGRCYR
LYSKSDFETRPLNQEPEIHRVHLGIAVLRILALGIRDVQGFDFIDAPSAKAIEMAIRNLV
QLGAIKLNNGVFELTEEGKFLVKLGIEPRLGKLILSCFRRRLGREGLVLAAVMANASSIF
CRVGSDDEKIKADCLKVQFCHRNGDLFTLLSVYREWDSLPREERNKWCWENSVNAKSLRR
CQDTIKELETCLEKELAIIIPSYWLWNPHKYTEYDKWLKEIILSALAENVAMFSGYDQLG
YEVAMTGQHVQLHPSCSLLIFGQKPTWVVFGELLSVNNQYLVCVTAFDFDSLSTLCPSPL
FDVSMMERKKLHVRVITGFGSILLKKFCGKSNSNVLSLVSRLRSTFMDERIGIEVNVDQN
QILLFASSQDIEKVLGLVSDVLEYEKKWLHNECIEKCLYQGAGVSPSVALFGAGAEIKHL
ELERRFLTVDVYHSNANILDDKELLMFLEKNASGSICSIHKFAVGQDSDEKDKWGRVTFL
TPDTAGKATELNGVEYNGSLLKVVPSRATLGGDNKMYTFPAVKAKVYWPRRLSKGFAVVK
CDATDVEFLVKDFFDLAIGGRYVRCEIGRRSMDSVVISGLDKELSEDEILGELRKVTTRR
IRDLFLVRGDAVECPQFDAFEEALLREISRFMPKRNSHANCCRVQVFPPEPKDAFMKAFI
TFDGRLHLEAAKALEQLEGKVLPGCGPWQKMKCQQLFHSSLSCPASVYSVIKEELNSLLA
TLNRVNGAECVVERNYNGSYRVRISSNATKTVADLRRPVEVLMRGRTVNHASLTPTILQH
LFTRDGINLRKSLQQETRTFILFDRHTLSVKIFGAPDNIAEAQQKLIQSLLTYHESKQLE
IHLRGGVLPPDLMKEVVRRFGPDLQGLKEKVPGAEFSLNTRRHVISVHGDRELKQKVEEI
IYEIAQTSDGSAERLHSEASCPICLCELEESYRLEGCTHLFCRSCLVEQCESAIKNMDSF
PIRCAHSGCKALILLTDLRSLLSNEKLEELFRASLGAYVASSGGTYRFCPSPDCPSVYRV
AEPGTAGEPFFCGACYAETCTMCHLEHHPYLSCEKYREFKEDPDSSLKEWCKGKEHVKTC
PICGYTIEKIEGCNHIECRCGRHICWVCLDIFNSANDCYGHLRSKHMSFI
NT seq 5193 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatcgtttcgtcacagtccggcgcgaaagtcgctgccaaattcgacacactac
caccagcacaacagacccaaaatcccgccgaaccaaaaacgccactccccttccgccacg
tcaccacccctcccccgccccaacttcataatccaactccgttcctccacgccagctatt
tccggacaggaactcaaagccttactcagcaaactcagcttgtcttgcgaagacgtcgcc
gtttccccctccggacctttaatcgcctccctttattttaaccaatgggtggacactctc
aacgccatggtcggtctgtgggagtcccggctgaatggggcccactgcttgaatttgaaa
ctgattccccacgtggtcgtcccttcggacgcggacgagcttgaagagaggctgaggaat
ttatttgtcgatcatgtcaagggtttgatggaaggcgagttggtcaacaagtggctgaag
atgaaggacgataaatgcgacgaaatttccaatgtttcgaaccggttgggaagtaggaat
agttatgctgttttctgcgagttgaatgagaggaagaaggggttgtttaaagagagggag
atgattatgagacgagtgagggagtttaagaatgctatgcactgtgttttgaagtatctc
gatgatcctcagaatgttgcgaaaaaggagtcctatgatgccaatgtcgacgtgtttaga
tttgaagactgccagcgctttgattggttcaggatacaggccttcattgtcagagagtgt
aagaggcttgaggatggcttgcctatctacatgtaccgccaagatattttgaggagaatt
tatggggaacagatattggtattgattggagagactggttgtggaaagagtacgcaattg
gttcagtttcttgctgattcaggaattgctgctgagcaatcgattgtatgtactcagcct
cggaagattgctgcaatctctttggcacagagggtcagagaagaaagtagagggtgttat
gaagatgattcagtcatatgttatccctcattttcttctgctcagcactttgattccaag
gtaatatatatgacagaccattgtttactgcagcatttcatgaatgatagggatttgtct
cggatttcatgcatcattgttgacgaggctcatgaaagaagcttgaacactgatcttcta
ttggcattggttaaagatttactttgtaggaggtttgatttaaggcttgtgataatgtca
gctacagcagatgcacaccagctctccaaatacttttatgactgtggaatctctcatgtg
gtgggaaggaactttccggtggatgtcagatatgttccttgtgccactgcaggaacttct
gctgtggcttcgtatgtttctgatgttgtaaggatggtgggggaggttcacacaactgag
aaagaaggaacaattcttgctttcttaacttctaagatggaagtagaatgggcttgtgag
aagtttgatgctccttctgcagttgcattgcctttccacggacagctttcatttgatgag
caattttgtgttttcaaaagctaccctgggagaagaaaagttatatttgccacaaatgtg
gctgagacttcgcttacaattcctggggtcaagtttgtgattgattctggcatggtcaaa
gagagttactttgaacctggcactggtatgaatgttctcagagtttgccgtgttagtcag
agttctgctaatcaacgagctggacgtgccgggagaacagaacctggaagatgttataga
ctttatagcaaaagcgattttgaaaccaggcctctcaatcaggagcctgagatacacaga
gttcatcttggtattgcagttttgaggatacttgccttgggaatcagggacgtgcaggga
tttgattttattgatgctcctagtgcaaaagccattgagatggccattaggaatcttgtt
caattaggagccattaagctgaacaatggtgtatttgaattaactgaggaaggtaaattc
ttggttaaattgggtatcgagcctcgtcttggtaaattgattctcagttgctttcgtcgt
cgattgggaagagagggccttgttcttgctgctgtaatggcaaatgctagtagcatattt
tgcagagttggtagtgatgacgagaaaataaaagctgattgccttaaggtacaattttgc
catcgcaatggtgacctctttacactgctctctgtgtacagggaatgggattctcttcct
cgagaggagagaaataaatggtgttgggaaaacagcgtaaatgccaaatccttgcgaaga
tgtcaagatacaatcaaggagttggaaacttgcctcgaaaaggaacttgctattattatt
ccaagttactggctctggaatccgcataaatacactgaatatgataaatggttgaaggag
atcatactctctgcccttgctgaaaatgtagctatgttctctgggtatgatcagcttggt
tatgaagtggcaatgactgggcaacatgttcagcttcatccttcatgttcattgttaata
tttggtcagaaaccaacttgggtcgtttttggtgaacttctatctgtaaataatcaatat
ctggtctgcgttacagcctttgactttgatagtttgtcaactctttgtccttctcccttg
tttgatgtgtccatgatggaaagaaagaagttgcacgtaagggtgataacaggttttgga
agtatcctcctaaagaagttctgtggtaagtcaaacagcaatgttctttctcttgtatca
cgtcttcggagtacctttatggatgaaagaattggtattgaggtcaatgttgatcagaat
cagattcttttatttgcttcttcacaggacatcgaaaaggttcttggtcttgtaagtgat
gttctggagtacgaaaaaaaatggttgcataatgaatgcatagagaaatgcttatatcaa
ggagctggtgtgtcaccatccgtcgcactgtttggagctggtgctgagatcaagcattta
gagctggaaaggagatttttgactgttgatgtctatcattcaaatgcaaatatcttggat
gataaggagcttttgatgtttcttgagaaaaatgcctctggtagtatttgttccatccac
aagtttgcagttgggcaagacagtgatgaaaaggacaagtggggcagggtaacatttctt
acacctgatactgctggaaaagctactgagctaaatggagttgaatataatggttctctg
ctgaaggtagttccttcacgggcaactcttggaggtgacaataaaatgtatactttccct
gcagttaaagcaaaagtttattggcctcgtaggcttagtaaggggtttgcagttgtaaag
tgtgatgcaaccgatgttgaatttctggttaaggatttttttgacctggcaataggagga
aggtatgttcggtgcgaaattggtagaaggtcaatggattctgtggtgataagtggactg
gataaagagctttctgaagatgaaattttaggggaattgaggaaagttactacgaggaga
attcgtgatcttttcctggtaagaggagatgctgtagaatgtccacaatttgatgctttt
gaagaagcgctcctgagagagatatctcgctttatgccaaagaggaattcccatgctaat
tgttgccgagtccaagttttcccacctgaacccaaggatgctttcatgaaggcttttatc
acctttgatggaagattacacttggaggcagcaaaagctttggaacaattggaagggaaa
gtattgcctggatgtggaccatggcagaaaatgaagtgccagcagttgtttcacagctct
ttatcttgtcctgcttctgtctattctgtgatcaaggaggaactgaattctttacttgca
acactcaaccgtgtgaacggtgctgaatgcgtggtggaaaggaattataatggttcttat
cgagtgagaatatcatccaatgctactaaaactgtggcagacctgagaagacctgtggaa
gtacttatgagagggaggactgtaaaccacgccagcctaactccaacaattttacagcat
ttgttcacaagagatggcatcaatctgaggaagtcactacagcaagaaacgagaactttc
attctctttgataggcatactcttagtgtaaagatctttggtgctccggataatattgct
gaggcccagcagaaattgattcaatctcttctgacctaccatgaaagcaagcaactggaa
atccatctccgaggtggagttctgcctcctgacctgatgaaagaagttgttagaaggttt
gggccagaccttcaaggtctgaaagagaaggtacctggggctgagttttcacttaacact
cgacgccatgtcatttctgttcatggagacagagagttgaagcaaaaggtggaagagata
atttatgaaattgcccagacgagtgatggctcagctgagagacttcatagtgaggcttct
tgccctatttgcttgtgcgaacttgaagagagttatagacttgaaggctgtacacatttg
ttttgtcggtcgtgcctggtggagcagtgtgagtctgcaataaaaaatatggatagtttc
ccaatacggtgtgctcacagcggttgtaaagctcttattttgctgacagatttgaggtct
ctattgtctaatgagaagcttgaggaactctttagggcttccttgggggcgtatgtggca
tccagtgggggcacctacagattttgtccatcgccggattgcccttcagtttatagagtt
gcagaacctgggacagccggcgagccattcttttgtggagcttgttatgctgagacttgt
acaatgtgccacttggagcaccatccttacctgtcatgtgaaaagtatagagagttcaag
gaggatccagattcatccctgaaggagtggtgcaaaggaaaagaacatgtcaagacctgc
ccaatttgtggatatacaattgagaaaatagaagggtgtaaccatatcgagtgtaggtgt
gggaggcacatttgctgggtctgtttagatatctttaatagcgcgaatgactgctatggg
catttgaggtccaaacacatgtcctttatatga

DBGET integrated database retrieval system