KEGG   Citrus sinensis (Valencia orange): 102608540Help
Entry
102608540         CDS       T02983                                 

Definition
(RefSeq) protein PHYLLO, chloroplastic isoform X1
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00130  Ubiquinone and other terpenoid-quinone biosynthesis
cit01100  Metabolic pathways
cit01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    102608540
Enzymes [BR:cit01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     102608540
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     102608540
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     102608540
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     102608540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M_2 MR_MLE_C Abhydrolase_6 Abhydrolase_1 TPP_enzyme_C Hydrolase_4 BAAT_C Abhydrolase_2 Abhydrolase_3 Ndr DLH Thioesterase DUF2974 LIDHydrolase Esterase DUF726
Motif
Other DBs
NCBI-GeneID: 102608540
NCBI-ProteinID: XP_006484287
Position
7
AA seq 1749 aa AA seqDB search
MDPFTLAVKAHHVHFTNSFSTESSISKHRLTKSLGIPKPSPPLTFLTRISGFRHFNSIDL
LRNSGSKVVEGLRFDGPVMDVDEIMDCEEGDLVVETSITRTLPPALTLEHGLESISEAVN
KLKTDPPSSSSGVLRFQVAVPPSAKALDWFCRQPESSEVFPVFFLSRDMENPTSKSLYLN
QNRGVFGIGAAVYFTHPAWCDSEERTKPKRYLSTNPIPITTYGFMDINFNTEPSCIKHEA
GSFYFFVPQIELRELDDISILAATLAWSNGMVCTFEQAIQSFESSFCQVSSHFCSSTERY
NPRYVRSALTKFNMMEDKTVQMVCMNAITLGRRDFGCDFMEMREAPFSFQFSFRFSPTLG
VANNMQLDNAIGMNYSLGDHVNINAVWASLLIEECSRLGLTYFCIAPGSRSSPLAVAAST
HPLITCIACYDERSLAFHALGYARGSHRPAVIITSSGTAVSNLLPAVVEASQDFVPVLLL
TADRPPELQDAGANQAINQVNHFGSFVRFFFSLPAPTDQIPARMILTTLDAAVHWATSSP
YGPVHINCPFREPLDNSPKHWMSSCLKGLDIWTSSIEPFTKYIQVQHSHACKSYTYGQMA
EVLELVQGVNKGLLLVGAVHNEDEIWAVLHLARHIRWPVVADILSGLRLRKLLASFLETE
QNILFLDHLDHALLSESVKDWIQFDVIIQIGSRITSKRISQMIEECFPCTYILVDNHPCR
HDPSHSVTHRIQSTIVQFVDFLLKVQVPHRSSKWCSFLRALDMMVASEISFQICTDYSLT
EPHVAHELSRALTSNSALFVGNSMAIRDVDMYGRNWTTCTRTVADIMLNSEFPQQWIRVA
GNRGASGIDGLLSTAIGFAVGCNKHVLCVVGDISFLHDTNGLAILKQRMKRKPILMLVMN
NHGGAIFSLLPIADRTEPRILDQYFYTTHNISIQNLCLAHGLNHVQVKTKVELEEALSMS
QHLGTDRVIEVESCIDANATFHSMLRKFARQSADHTLNVLSQFSVPDTISCSLSICKICR
MEYSLYRIQLCALPTSSYIDHNRSRFCREGFILSLYLEDGSVGYGEVAPLEIHKENLLDA
EEQLRFLLHFMTGAKISYFLPLLKGSFSSWIWSTLGIPACEIFPSVRCGLEMAILNAIAV
KHGSSFLNILYPLTEIDEEISKRSTSIKICALIDSNKSPVEVASIATTLVEEGFTAIKLK
VARRADPIKDAEVIQEVRKKVGHRIELRVDANRNWTYQEALEFGFLVKDCDLQYIEEPVQ
NEEDIIKYCEESGLPVALDETIDKFQKDPLNMLEKYAHPGIVAIVIKPSVIGGFENAGLI
ARWAQRHGKMAVVSAAFESGLGLSAYIIFSSYLELQNAYLCKVMNRELCPPVAQGLGTYQ
WLKEDITTDPISICHNSCSGFVEASVAKATHILQNLQINNDVICKTSMEEQVLRYQLNVN
SKDFCSFIKVQEIGQRIDIQDNILLFLHGFLGTGEEWIPIMKAVSGSARCISIDLPGHGG
SKMQNHVAKATQEITTKATQEITLSIDVIADVLYKLIEQITPGKVTLVGYSMGARIALYM
ALRFSDKIKGTVIISGSPGLRDNIARKIRRAEDDSRACALVTHGLQVFLDTWYTGELWES
LRSHPHFNRIVASRLLHEDVQSLSKALSDLSVGRQPPLWEDLKLCSTPLLIVVGEKDKKF
KSIAEKMCYELSHDEKGSDDLRNQIYEMVEIPNCGHAVHLENPLPVIRAVRQFLTRVNQN
STSNPESNG
NT seq 5250 nt NT seq  +upstreamnt  +downstreamnt
atggatccattcacccttgctgtgaaagctcatcatgtacatttcacaaacagtttttcc
acagaatcttcaatctcaaaacatcgactcacaaagtcacttggcatcccaaaaccatca
ccacctctcacattcctcaccagaataagcggcttccgtcactttaactctatcgacctt
cttcgcaactctggctccaaggttgtggaagggttgagatttgatgggccagtgatggat
gttgacgagataatggactgtgaagaaggcgatttggtggtggagactagcattactcgt
actctgcctccggctttgactcttgaacatggactcgagagtatttctgaggctgttaac
aagttgaagacggacccacctagctcttctagtggagttttaaggtttcaggttgctgtt
cctccaagtgcaaaagctttggattggttttgtcgccaaccagagtcgtcggaagtattt
cctgtatttttcctttccagggacatggagaatccaacatctaaatcactgtatttgaat
cagaaccgtggagtgtttggaattggagctgctgtttactttactcatcctgcttggtgt
gactcagaagagaggactaagcccaaaagatatctatcaactaatccaatccccataaca
acttatggttttatggatattaatttcaatactgagccatcttgcatcaaacacgaggct
ggttctttttacttctttgttcctcagattgagctaagggagcttgatgatatctctatc
ttagcagcaacactggcatggagtaatggtatggtttgtacatttgagcaggctattcaa
tcatttgaatcatccttctgccaggtcagtagtcatttctgttcctctacagagagatac
aaccccagatatgtaagatctgctctcacaaagttcaacatgatggaggataaaactgtc
caaatggtatgcatgaatgccatcacattgggcagaagggattttggttgtgatttcatg
gaaatgagagaggctccattttccttccagttctctttcagattttcaccaacccttggt
gttgctaataacatgcagttggataatgccattggaatgaattactccttaggagatcat
gttaatatcaatgctgtttgggcttcgcttttgattgaagaatgttctcgtcttggtttg
acgtatttttgtatagctccaggttcaagatcatctcctcttgctgttgctgcttccact
catcccctaataacatgtattgcttgctatgatgaacgctcacttgcttttcatgctctt
ggttatgcaagaggatctcacagacctgctgtgattattacttcatcaggcactgcagtt
tcaaatcttcttccggctgttgtggaagccagtcaggattttgtgccagttctattgctt
acggcagatcgtccgccagagcttcaggatgctggggctaaccaagcaatcaatcaggta
aatcattttggctcttttgtaaggttcttcttcagtcttcctgcacccactgatcagatt
cctgcacgaatgatacttaccacgctcgacgctgctgtgcattgggctacctcatcgcct
tatggtcctgttcatatcaactgccctttcagggagccactggataatagtccaaaacac
tggatgtctagttgtttgaaaggattagatatttggacgtctagcattgaaccattcact
aaatatattcaagtgcaacactctcacgcatgcaagagttatacttatggccaaatggca
gaagttctggaactagttcaaggtgttaacaaagggcttcttctggttggtgcggtccat
aatgaggatgagatatgggcagttcttcacttggctagacacattcgatggcctgttgta
gctgacattttgtcaggattacgattgagaaaactcttggcttcctttcttgagactgaa
caaaatatcttatttcttgaccatcttgatcatgctctgctttcagaatctgtcaaggac
tggatacagtttgatgtaattattcagattggaagtcggattacaagtaaaaggatttct
cagatgatagaggaatgttttccatgcacatacatcttggttgacaatcatccatgtcgt
catgatccttcccattctgtaactcacaggatccagagcacaattgtccaatttgtggat
tttttgcttaaagttcaagttccacataggagtagcaaatggtgcagctttctacgagca
cttgatatgatggttgcatcagagatatcatttcaaatttgcactgactactccttgact
gaacctcatgtggcacatgaactttccagagcattgacatctaattctgcactttttgtt
gggaacagcatggcaatacgagatgtagatatgtatggacgtaattggacaacttgtact
cgtactgttgcagatataatgctaaactcagaatttcctcagcaatggataagggtggct
ggaaataggggagctagtggtattgatggtttgcttagcacagctattggttttgctgta
ggatgtaataaacacgtactgtgcgtagttggagatatttctttccttcatgatacaaat
ggtttggcaatattgaaacagaggatgaagcggaaaccgattctgatgcttgtgatgaac
aatcatgggggtgcaatcttcagccttcttccaattgcagatagaactgaaccaagaata
ttggatcagtatttctacaccacccataacatttccatccaaaatctatgtttggcgcat
ggtttaaatcacgtacaagtgaagacaaaagtagaacttgaagaggctttatccatgtcc
cagcatctcgggacggatcgtgtcattgaagttgagagctgcattgatgccaatgccaca
ttccacagtatgttaagaaaatttgcacgccaatcagcagatcatactttgaacgtcctt
tcacagttttctgttccagatactatttcatgtagtctctctatttgtaagatctgtaga
atggaatattctctgtataggattcaactttgcgcacttcctacgtcaagttatatcgat
cataatcgaagtagattctgtagagaaggttttattttatcgttgtatcttgaagatggg
agtgtcgggtatggtgaggttgcacctcttgaaatccacaaggaaaacctgctggatgca
gaagagcaacttcgctttcttcttcattttatgacaggagctaaaatcagttattttcta
cctctgctgaagggctcattttcttcatggatatggagcacattaggaatacctgcatgt
gaaatatttccgagtgtcagatgtggtttggaaatggctatcctcaatgccattgcagta
aaacatggttccagtttcttgaacattctctatcccctgacagaaatagatgaagaaata
tctaaacggtcaacaagtataaagatatgcgccctcattgattcgaataaatctcctgtg
gaggttgctagcattgccaccactcttgtggaagaagggttcactgcaatcaaactcaaa
gttgcacgccgggcagatcccattaaagatgcagaagttatacaagaagtaagaaagaag
gttggtcacaggattgaactccgtgtggatgccaatcgtaactggacctatcaagaagct
cttgaatttggtttcttagttaaagattgtgacttgcaatatattgaggagcctgttcag
aatgaagaggatattataaagtactgtgaagaaagcggcttgcctgtagcgttggatgaa
accattgacaaattccaaaaagatcctcttaatatgcttgagaagtatgctcacccagga
atagttgctattgtgatcaaaccaagtgtcattggtggatttgaaaatgcaggattaatt
gcaagatgggcccagcgacatgggaagatggctgttgtcagtgctgcctttgaaagtggt
ctaggtttgtcagcatatatcatattttctagctatctggagctgcagaatgcatattta
tgcaaagtgatgaatcgtgaactgtgcccccctgtagcccaaggtcttggaacttatcag
tggcttaaagaagacataacaactgatcctatcagtatttgtcataattcgtgtagtggc
tttgtagaagcatctgttgctaaagctacccacatcctgcagaacttacaaattaataat
gacgttatatgtaaaacttccatggaggagcaagttttgagataccaattgaatgtgaat
tcaaaggatttctgcagtttcatcaaagtgcaagagattggacaaagaattgatatacag
gataacatacttctgtttctccatggctttcttggaactggtgaagaatggattcctatt
atgaaggccgtctcaggatcagcaagatgcatctcaattgatctccctggtcatggggga
tcaaagatgcaaaatcatgttgctaaagccacacaggaaataactactaaagccacacag
gaaataactttgtcaatagacgtcattgcggacgtactatataagctgattgaacagatt
actcctggaaaagttactctagttgggtattctatgggagcaagaattgccttgtatatg
gccctgagattcagtgataagatcaaaggaaccgttataatatctggaagcccagggcta
cgagataatatagcaagaaaaattcgtagggctgaagatgattctagagcgtgcgccctt
gtcactcatggtctgcaagtctttctagatacctggtatactggggagctctgggaaagc
ttgagaagccatccccattttaatcgaatagttgccagccgcttgttgcatgaagatgtg
cagagtctttcaaaagctctgtcagatttaagtgttgggagacagccgccattgtgggaa
gatttgaagctatgcagcacacctctcttgattgttgtcggagagaaagataagaaattc
aagtcaattgctgaaaaaatgtgctatgaacttagccatgacgaaaagggtagtgatgat
ctgaggaatcagatttatgagatggttgaaatccccaattgcggccatgctgtccatctg
gagaatcctctgcccgttatccgtgctgtgagacagtttctgaccagagtaaatcagaat
tcaacttcgaatccagagtccaatggatag

DBGET integrated database retrieval system