KEGG   Citrus sinensis (Valencia orange): 102609096Help
Entry
102609096         CDS       T02983                                 

Definition
(RefSeq) nicotianamine synthase-like
  KO
K05953  nicotianamine synthase [EC:2.5.1.43]
Organism
cit  Citrus sinensis (Valencia orange)
Brite
KEGG Orthology (KO) [BR:cit00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102609096
Enzymes [BR:cit01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.43  nicotianamine synthase
     102609096
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAS Methyltransf_31 Methyltransf_25 Methyltransf_12 Methyltransf_23 Methyltransf_11 CheR Methyltransf_2 TPMT Glyco_hydro_42M
Motif
Other DBs
NCBI-GeneID: 102609096
NCBI-ProteinID: XP_006474635
Position
4
AA seq 284 aa AA seqDB search
MASLQNAKNESHIPAELLIARVMQIHACICKLESLKPSKQVNSLFTHLVKLCTPPSSIDI
KTLPQEVQEMRESLIVLCGRAEGLLELEFATFFAKTPQPLNNLNLFPYYGNYVKLANLEY
RILDENGVVQPKKVAFVGSGPMPLTSIVMAKNHLKSTHFDNFDIDEAANDVARQIVSSDI
EFEKRMKFVTCDIMQVKEKLGEYDCIFLAALVGMSKEDKVKIIKHIRKYMKDGGVLLVRS
AKGARAFLYPVVEKHDLLDFELLSVFHPTNEVINSVVLVRKPLF
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcttccctccaaaatgccaaaaatgaaagccacattccagctgagctcctcatagct
cgcgttatgcaaatccatgcttgcatatgcaagctggagtctctgaaaccatcgaagcaa
gtcaatagcctcttcactcaccttgtgaagttatgtactcccccttcttccatagacatt
aaaacgttaccgcaagaagttcaagaaatgcgcgaaagtctcatagttctttgtggtcgt
gctgagggcttacttgagctagaatttgcaacattttttgccaaaactccacaaccactt
aacaatctcaatctcttcccatattatggaaattatgtcaagctggccaatttggaatat
agaatcctcgatgaaaatggagtggtgcaaccaaagaaggtggcatttgtgggttcaggt
ccaatgcctcttacttctatagtaatggctaaaaatcacctgaaatccacccactttgac
aactttgacattgatgaggcagccaatgatgtggctcgccaaattgtttcttctgatatt
gagttcgagaagaggatgaagtttgtgacatgcgacataatgcaagtgaaagagaagcta
ggggaatacgattgcatattcttggcagctctagttggaatgagcaaagaagacaaagtg
aagattatcaagcatataaggaagtatatgaaggatggaggagttttgctggtgaggagt
gcaaaaggagccagagcatttctgtatcctgttgtggagaagcatgacttgctcgatttt
gagcttctctccgtcttccatccaactaatgaagtcataaactccgttgttctcgttcgc
aagcctttgttttga

DBGET integrated database retrieval system