KEGG   Citrus sinensis (Valencia orange): 102609271Help
Entry
102609271         CDS       T02983                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cit00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    102609271
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cit03012]
    102609271
Translation factors [BR:cit03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    102609271
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI Peptidase_S21
Motif
Other DBs
NCBI-GeneID: 102609271
NCBI-ProteinID: XP_006472154
Position
3
AA seq 987 aa AA seqDB search
MSTYAKPEAALNQAEALINVGQKQDALQVLHDLITSKRHRAWQKILEKIMFKYVELCVDM
RRGKFAKDGLIQYRIVCQQVNVTSLEEVIKHFMHLSTEKAEQARSQAQALEEALDVDDLE
ADKRPEDLMLSYVSGEKGKDRSDRELVTPWFKFLWETYRTVLEILRNNSKLEALYAMTAH
RAFQFCKQYKRTTEFRRLCEIIRNHLLNLNKYRDQRDRPDLSSPESLQLYLDTRFEQLKV
ATDLQLWQEAFYSVEDIHGLMCMVKKTPKPSLLVVYYAKLTEIFWISSSHLYHAYAWFKL
FTLQKTYNKNLSLKDLQLIASSVVLAALLVVPYDRSRSASHLELENEKDRNLRMANLIGF
ELDPKFDSREALSRSSLLSELVSKGVMSCATQEVKDLYNLLEHEFLPLDLASKVQPLLAK
ISKYGGKLASASSVPEVQLSRYIPALEKLVTLRVLQQVSEVYQMMRIESLSQMIPFFDFA
VVEKISVEAVKHNFIAMKIDHMRGVVVFCNLGLESDGLRDHLTIFTQSLNKVRAMIYPPA
NKASKLGDMLAGLGEIVDKEHKRLLARKSIIEKRKEEHERQLIEMEREEESRRLKQQKIT
EEAEQKRLVAEFEHRKNQRILREIEERELEEAQALLEEAEKRSKKKGGKKPILEGEKVTK
QTLMERALTEQLRERQEMEKKLQKLAKTMDYLERAKREEAAPLIDAAFQRRLEEEKVLHE
REQQLEVELSRQRHDGDLREKYRLSRMLDNKNIFQERVLNRRRVEVDRRKVEREERISLI
IKARKQEREAKRKKIFYVRTEEEKIKRLREEEEARKREEAEKRKKEEAERQAKLDELAEK
QRQRERELDEKERLRKEAILGRSSDGASKPFEPPVRTSEPGSAAPAAAAAAAAPTSGKYI
PRHLRAKMEGAGVGGQSAPPQSEERWAGGTRPEQWGPSRRTDGSSQVPPEADRWGRPDDR
SGPPSDRWRPGGGSRSSSTWSSSRPPR
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacttatgccaaacctgaggcagcattgaatcaagctgaagcattgatcaatgtt
ggacagaagcaagatgccttacaagttctccatgatttgataacttctaaaagacaccgg
gcatggcaaaagatacttgagaagataatgttcaagtatgttgagctttgcgttgacatg
cgaagaggcaagtttgcaaaggatggtttaattcaatatcgaattgtttgtcaacaagtg
aacgtgacttccttggaggaggtcatcaagcacttcatgcatctgtccactgagaaggca
gagcaggctcgtagtcaggcacaagctctagaagaagctcttgatgttgatgaccttgaa
gcagataaaaggccagaagatctaatgcttagttatgtaagtggggagaagggaaaggat
aggtctgatcgtgaacttgttacaccttggttcaagtttttgtgggagacttatagaaca
gtgcttgaaatattgcggaacaactcaaagttggaggcactatatgcgatgactgcacac
cgtgccttccaattctgcaagcaatacaagcgcacaactgaatttcgcaggctttgtgaa
attatccggaaccatttgttgaaccttaacaagtacagagatcaaagggatcgtcctgac
ctttcttcccctgagagtttgcaactctatctggacaccagatttgagcagctgaaggtt
gctactgaccttcagctctggcaggaagcgttttattctgttgaagatatacatggtttg
atgtgcatggttaagaaaactccaaagccgtcactgctagttgtttattatgcgaagcta
acagagatattctggatatcatcaagccatctttatcatgcttatgcgtggttcaagctt
tttacgctccagaaaacatacaataagaatttaagcctaaaagatttgcagctaatagca
tcatctgttgttttggctgcacttctagtggttccttatgaccgcagtcgcagtgcatct
catttggagcttgaaaacgagaaggatcggaacttgaggatggctaatcttataggattt
gagcttgatcctaaatttgatagtagagaagcgctttcaagatcctcccttctctcagaa
ttggtgtccaaaggtgttatgagctgtgcaactcaggaagtgaaagacctttacaatctt
ttagagcatgaatttcttcctctagatcttgcctcaaaggtgcagcctttgttggccaaa
atctcaaagtatggtggtaaacttgcttcagcttcttctgtaccggaagtgcaactttcc
cgttatattcctgctcttgaaaagcttgttacccttagggtgcttcaacaggtgtcggag
gtgtatcagatgatgagaattgagagcttatctcagatgattcctttctttgattttgct
gtcgtggagaaaatttctgttgaagctgtgaaacataatttcatagctatgaaaattgac
catatgagaggtgttgtagttttttgtaatttgggccttgaatctgatggtctaagggat
cacctgactatttttactcagtctttaaataaagtgcgggccatgatatatcctcctgca
aataaggcatcaaagctaggtgatatgttggctggtttaggggagattgtagataaggaa
cataagaggcttcttgctcggaaatcaatcattgagaaaaggaaggaagagcatgaacgc
caacttattgaaatggaacgtgaagaagagtctaggaggctaaagcaacagaagataaca
gaggaggctgagcagaagaggcttgttgctgaatttgagcataggaaaaatcaaaggatc
ctcagagaaatagaggagcgtgaacttgaagaagcgcaagcattgcttgaggaagctgag
aagcgcagtaaaaagaagggaggcaaaaagccaatcttggagggggaaaaagtgacaaaa
caaactttgatggagcgagccctgaccgagcagctgagggagaggcaagagatggagaaa
aagttacaaaaactagccaagacaatggattatttggaaagagcaaaaagagaagaggct
gcccccttgattgatgctgctttccaacgacggttggaggaggagaaggtgcttcatgaa
cgtgaacaacagctagaggttgagttgagcaggcagcgacatgatggagacctgagggaa
aagtataggctttcaaggatgttggacaacaagaacatattccaggaaagagtgctgaac
cgtcgaagagttgaggtcgacaggcgcaaagtggagagggaggaaagaatcagcctaatt
attaaggcccgaaaacaggagagggaggctaagagaaagaagatattctacgttaggact
gaagaagagaaaataaaaaggctgcgtgaggaggaagaagctcgtaagcgtgaagaggct
gagaaacgaaagaaggaagaagctgaacgccaggcaaaattggatgagcttgctgaaaaa
cagaggcaaagagagcgagagcttgatgaaaaagaacgactcagaaaagaagctatcttg
gggaggtcatcggatggggcttctaaacctttcgagcctcctgttcgtacatcagagcct
ggatctgctgctcctgctgcagctgcagccgcagctgcaccaacctctggaaaatacatc
cccaggcacctgcgtgcgaaaatggaaggtgcaggtgtaggtgggcaatcagcacctcct
caatctgaggagcggtgggccggcggtaccagaccagaacaatgggggcccagcaggcgg
actgatggttccagtcaggttccacctgaagctgatcgctggggcaggccagatgatcgc
tcaggcccacccagtgataggtggcgtcctggtgggggctcaaggtcatcctccacttgg
tcatcatcgagaccaccacgttga

DBGET integrated database retrieval system