KEGG   Citrus sinensis (Valencia orange): 102610991Help
Entry
102610991         CDS       T02983                                 

Definition
(RefSeq) autophagy-related protein 16
  KO
K17890  autophagy-related protein 16-1
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:cit00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    102610991
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cit04131]
    102610991
   03029 Mitochondrial biogenesis [BR:cit03029]
    102610991
Membrane trafficking [BR:cit04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    102610991
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    102610991
Mitochondrial biogenesis [BR:cit03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    102610991
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 Nup160 Cytochrom_D1 GOLGA2L5 Ge1_WD40 PQQ_2 DUF5046 Exonuc_VII_L YlqD Hormone_1 DUF2383 GCD14 Phlebovirus_NSM DUF4854 V_ATPase_I
Motif
Other DBs
NCBI-GeneID: 102610991
NCBI-ProteinID: XP_006476932
UniProt: A0A067FPT8
Position
5
AA seq 510 aa AA seqDB search
MSQEEIAREAIKHALKALRKRHLVEEGAHAPAIIALSRPIISQGSEWKEKADNLETELQQ
CYKAQSRLSEQLVVEVAESRSSKALLQEKESLITSLQEELTQIRDECSQLKTELEEKIKA
LELVVSENQQIRAQLEEMTMKAKNAEAENKMLVDRWMLQKMQDAERLNEANALYEDMIDR
LKASGLEKLAKQQVDGVVRRSEEGAEFFAESTVPSTCKHKINAHEGGCASILFEYNSARL
ISGGQDKSIKLWDTNTGSLSSTLYGCLGSVLDLAITHDNRSVIAASSSNNLYVWDVNSGR
VRHTLTGHTDKVCAVDVSKISSRHVVSAAYDRTLKVWDLHKGYCVNTIIFHSNCNALAFS
MDGQTIFSGHIDGNLRLWDIQTGKLLSEVAAHSLAAVTSISLSRSGNIILTSGRDNLHNL
FDIRSLEVCGSLRATGNRVASNWSRSCISPDESYVAAGSADGSVYIWSISKADIVRTLKE
HTAPVLSCSWSGLGKPLASADKNGVVCVWT
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagaggaaattgcaagggaagctataaagcacgctctcaaggcgttgcggaaa
cggcatttagtggaagaaggcgctcatgctcccgccattatcgctctttcaaggccgatc
atttctcagggatccgaatggaaggagaaagcggataatctggaaacagagcttcagcaa
tgttacaaagctcaatctaggttatcagagcagcttgtggttgaagtagctgagtctaga
tcttctaaagctttattgcaagagaaagaatcactgattacttcactacaggaagaattg
acgcaaataagggatgaatgttctcagttgaagacggaattggaagaaaagatcaaggct
ttggaattagttgtgagcgagaaccagcaaatcagagcacagctagaagagatgactatg
aaagctaaaaatgctgaagctgaaaataaaatgttagttgatagatggatgttgcaaaag
atgcaggacgctgaacggctaaatgaggcaaatgcactttatgaagatatgattgatcgg
ctcaaggccagtgggttagagaaacttgctaaacagcaggtagatggtgtggttcgccga
agtgaagaaggtgctgagttctttgcggagtcaactgttccatctacatgcaaacataag
atcaatgcccatgaaggtggctgtgcatccatattgtttgaatacaattctgccagattg
attagtggtggacaggacaagtcaattaaattgtgggatacaaacactgggtcattaagc
agtaccctctatggttgccttggctcagttcttgatcttgctattacccatgataataga
tctgtcattgctgcaagtagctcaaacaacttgtatgtttgggatgtcaactcagggcgt
gtccgtcatactctcacaggtcacacagataaagtgtgtgctgtagatgtgagcaaaatt
tcaagccggcatgtcgtaagtgcagcttatgatcgtactttaaaagtgtgggatttgcat
aaaggttactgtgtgaacacaatcatttttcacagcaactgtaatgctcttgccttcagt
atggatggacagaccatattttctggtcatattgatgggaatctgcgtttgtgggatatt
caaacaggaaagctacttagtgaagttgctgcacattcacttgctgcagttacatctatc
tctttgtcgcgaagtggaaacataatactaactagcgggcgagacaacttgcacaactta
tttgatatacggtctttagaagtttgtggctcactaagagcaactggaaacagagtggca
tctaattggagccgatcctgcataagtccggatgagagctatgttgctgctggctcagct
gatggatctgtatatatctggtcaatatctaaagctgatatagtgagaacgttgaaggag
cacacagctcccgtactgagttgttcatggagtgggcttggaaaaccgctggcatctgct
gacaagaatggagttgtttgtgtttggacgtga

DBGET integrated database retrieval system