KEGG   Citrus sinensis (Valencia orange): 102614014Help
Entry
102614014         CDS       T02983                                 

Definition
(RefSeq) NAD-dependent protein deacetylase SRT1-like isoform X3
  KO
K11416  mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
cit  Citrus sinensis (Valencia orange)
Brite
Enzymes [BR:cit01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102614014
Chromosome and associated proteins [BR:cit03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     102614014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SIR2
Motif
Other DBs
NCBI-GeneID: 102614014
NCBI-ProteinID: XP_006469445
Position
2
AA seq 356 aa AA seqDB search
MSLGYAEKLSYREDVGSVGMSEIFDPPHLLQQKIAELAVMIKKSKHLVAFTGAGISTSCG
IPDFRGPKGVWTLQREGKGVPEASLPFDRAMPSITHMALVELEKAGILKFVISQNVDSLH
LCSGIPREKLAELHGNSFREICPSCGVEYMRDFEIETIGMKKTPRRCSDVKCGSRLKDTV
LDWEDALPPVEMNPAEENCRMADVVLCLGTSLQITPACNLPLKSLRGGGKIVIVNLQQTP
KDKKASLVVHAPVDKVIAGVMHHLNLWIPPYVRVDLFQINLDQYSRPSRSDKYVKWALRV
GSVHRPKAPSPFVQSVEVSFSDRPDLKTAILNKQPFKLKRRKQITSAMIRTPLFGS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgggttatgcagagaagctttcttacagagaagatgtgggcagtgttggaatg
tccgaaattttcgacccacctcacctgttacaacaaaaaattgcagagcttgcagtaatg
ataaagaagagtaagcatctggtggcatttacaggtgcagggatatcaacttcttgtggg
attcctgattttagaggtcccaaaggagtttggacgcttcaacgtgaaggcaaaggtgtg
cctgaagcatcactaccatttgatcgtgcaatgccaagtattacccatatggccttggtt
gaacttgagaaagccggcatcttaaagtttgttataagccagaatgtcgatagcctgcat
ctgtgttctggaataccaagggagaaacttgctgagttgcacggcaattcttttcgagaa
atttgcccatcttgtggagtagagtatatgcgtgattttgagatagaaaccattggtatg
aagaaaacaccacgccgttgttctgacgttaaatgtgggtcaagacttaaggacactgtt
cttgattgggaggatgcattgccaccagtagagatgaatccagcagaggaaaactgtagg
atggcagatgttgttctatgcttgggtaccagtttgcagattactccagcttgcaacctt
cctttaaaatcacttcgtggtgggggtaagatcgtaattgtaaacctacagcaaacgcca
aaggacaagaaagcaagtttggttgttcatgctcctgttgacaaggtgattgcaggggtt
atgcatcatcttaatctgtggattcctccttatgttcgagtagatctttttcagattaat
cttgatcagtactctaggccatcacgatcagacaagtatgtgaaatgggctctcagggta
ggcagtgttcacagacccaaagctccatcgcccttcgtccaatcagtcgaggtttctttc
tcagacaggccagatcttaaaacagccattttgaataaacaaccattcaagctgaaaagg
aggaagcagataacatcagccatgataaggacaccgttgttcggaagctga

DBGET integrated database retrieval system