KEGG   Citrus sinensis (Valencia orange): 102615053Help
Entry
102615053         CDS       T02983                                 

Definition
(RefSeq) histidine kinase 3
  KO
K14489  arabidopsis histidine kinase 2/3/4 (cytokinin receptor) [EC:2.7.13.3]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:cit00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04075 Plant hormone signal transduction
    102615053
Enzymes [BR:cit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     102615053
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CHASE HATPase_c Response_reg HisKA ELO Como_LCP 7TM_GPCR_Str
Motif
Other DBs
NCBI-GeneID: 102615053
NCBI-ProteinID: XP_015387432
Position
7
AA seq 1033 aa AA seqDB search
MSLLHVFGFGLKVGHLLWMLCCWIVSVISMNCFMNYESKDTKTDLRGEVFKMWLNCWERI
SGNSYYIHHLYYQSIGSKRVRETWWRKVLITWLLFWTLVSLWIFWYMSSQATEKRREALG
SMCDERARMLQDQFNVSMNHVQAMSILISTFHHGKNPSAIDQMTFTRYTERTAFERPLTS
GVAYAVRVLRSEREEFEKQQGWTIKRMDTFEHNPVHKDEPSPIEEEYAPVIFAQDTVSHV
ISLDMLSGKEDRENVLRARASGKGVLTAPFRLLKTNRLGVILTFAVYKRELPSNATPNER
IEATDGYLGGIFDIESLVEKLLHQLASKQTIFVNVYDITNLSHPISMYGSNVSDDGLWLV
STLNFGDPFRKHEMRCRFKQKAPWPLLAISTSIGILVIASLVGHIFQATVNRIAKVEEDY
HGMMELKKKAEAADVAKSQFLATVSHEIRTPMNGVLGMLDMLMDTELDVTQQDYVRTAQA
SGKALVSLINEVLDQAKVESGKLELEAVSFNLRAILDDVLSLFSGKSQDKGVELAVYISD
RVPETLIGDPGRFRQIITNLMGNSIKFTEKGHIFVTVYLVEEVVDSIEVETELSSSKNTL
SGYPVADRCHSWKGFKTFNQDGSTSPFKSSSADLINLIVSVEDTGQGIPLEAQSRIFTPF
MQVGPSISRTHGGTGIGLSISKYLVGRMKGEIGFVSIPNIGSTFTFTAVFGNGSSTSNEH
NSQQMNNQPNSVSSEFQGMKALVVDPRPIRAKVSRYHIQRLGIQVEVVSDQLQCLSQIAS
GSKIINMILVEQEVWEKDTSVSTLFVNNLRKLGCGFQSKLFLLANSISSSRANTSTDGVS
IPTVIMKPLRSSMLAASLQRAMGVGNKGNIRNWELPSMSLRHLLLGRKILIVDDNNVNLK
VAAAGLKRYGAAVVCVERGKKATELLMPPHQFDACFMDIQMPEMDGFEATKIIREMEHNF
NNRIRRGEVSIEAYENVSNFHVPILAMTADVIQATYEECLRSGMDGYVSKPFEAEQLYRE
VSRFFPPIPDRSP
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgcttcatgtgtttgggtttggtttaaaggtggggcatttactttggatgcta
tgctgctggatagtttctgtgatttcaatgaactgcttcatgaattatgaaagcaaggat
accaagactgatttgcgtggtgaagtttttaagatgtggctaaattgctgggagaggatc
tcagggaacagttactacattcatcatttgtattaccagtctattgggtccaaaagagtt
agagaaacatggtggagaaaagtcttaatcacatggttgcttttttggactttggtttct
ctgtggatcttttggtacatgagctcacaagccaccgagaagaggagagaggctcttggt
agtatgtgtgatgagagggctaggatgttacaggatcagtttaatgtgagcatgaaccat
gttcaggctatgtccatactgatctcaactttccaccatggcaagaacccgtctgctatt
gatcagatgactttcactaggtacacagaaagaactgcttttgaaaggccgctcacaagt
ggcgtggcatatgctgttagggtgctccgctctgaaagggaagaatttgaaaagcaacaa
ggctggactattaagaggatggataccttcgaacataatcctgttcataaggatgagcca
tccccaatcgaagaagaatatgctccagttatctttgcacaggatactgtttcacatgtg
atttctcttgatatgctttcaggaaaagaagatcgtgaaaatgtgttgcgagcaagagca
tcaggaaaaggagtcctaactgctcctttcaggttactgaaaacaaaccgtctcggagtt
attttgacatttgctgtctacaagagggagctcccctcaaatgctactccgaatgagagg
attgaagcgactgatgggtatcttggtggaatctttgacattgaatcacttgtggagaag
ttacttcaccagttagcaagcaaacaaaccatatttgtgaatgtatatgacatcacaaat
ttatctcatccaatcagcatgtatggttcaaatgtatcagatgatggtttgtggcttgtt
agcacccttaattttggagatccgtttagaaagcatgagatgcgttgcagattcaagcaa
aaagccccatggccattgttggcaatatcaacttcaataggcatccttgtgattgcatca
cttgttggacatatattccaggcaactgtgaatcgaattgctaaagttgaagaagattac
catgggatgatggagcttaaaaagaaggctgaggcagctgatgttgcaaagtcacagttc
cttgctactgtttctcatgagatcagaactccaatgaatggtgttctagggatgttggat
atgcttatggatacagaattagatgtcactcaacaggattatgtcagaactgcgcaagcc
agcggtaaagctctcgtctcactgataaatgaggttttggatcaggcaaaggtcgaatct
ggtaagcttgagcttgaggcagtgagctttaatctacgggcaattttggatgatgtatta
tcactcttttctgggaagtctcaagataaaggcgtagagttggcagtatatatctctgat
cgcgttcccgaaactctaattggtgacccggggaggtttcgacaaatcatcaccaatctt
atggggaactcaattaaattcacagaaaaaggacacatctttgtcactgtttaccttgtt
gaagaggtggttgactctatagaagttgagacagaattgtcatcatcaaagaacaccttg
agtggttatcctgttgcagacagatgccacagctggaaaggatttaaaactttcaatcaa
gatggatcaactagtccgttcaaatcatcatccgctgatctcatcaatttaattgtgtca
gttgaagatacaggtcaaggaatccctctagaagcccaatcccgcattttcacccctttt
atgcaggttggtccatctatttcccgaactcatggaggtacgggtattgggctaagcata
agcaagtatttggttggccgcatgaagggtgaaattggatttgttagcattccaaacatt
gggtctacttttacatttactgctgtctttggcaatggctcctccacttcaaacgagcac
aatagccagcaaatgaacaaccagccaaactctgtgtcttcagaatttcaaggtatgaag
gcattagttgtggaccccagacccatccgagccaaggtgtcgagatatcatatccaacgt
cttggaattcaagtcgaagtggtttctgaccagcttcaatgtttatctcaaatagccagt
ggtagtaagattatcaacatgatccttgtcgagcaagaagtttgggagaaggatactagt
gtttcaaccctttttgttaacaacttgagaaaacttggttgtgggtttcagtcaaagctg
tttcttctggctaattctatcagctcttctagagcaaacacttcaactgatggtgttagt
attcctaccgtaatcatgaagcccctaagatcgagcatgctggctgcatctctacaacga
gccatgggtgtcgggaacaagggtaatatccgcaattgggagctccccagcatgtctctg
cgtcatcttcttttagggagaaaaatattaatcgttgatgacaataatgtgaacctcaaa
gtagctgctgctggtttgaagaggtatggagctgctgtggtttgtgtagagagaggtaaa
aaggcgactgagctgctcatgccaccccatcagtttgatgcctgcttcatggatatccag
atgccggaaatggatgggtttgaagctacaaagataattcgggaaatggaacataatttc
aacaatcgaattcgacgcggagaagtatctattgaggcctatgaaaatgtttcaaacttc
catgtacccattttggccatgactgcagatgtgatccaagctacttatgaggaatgccta
aggagtggaatggatggatatgtttcaaaaccatttgaagctgaacaactatatcgagaa
gtttcacgttttttcccaccaattcctgataggagtccatag

DBGET integrated database retrieval system