KEGG   Citrus sinensis (Valencia orange): 102615443Help
Entry
102615443         CDS       T02983                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00010  Glycolysis / Gluconeogenesis
cit00562  Inositol phosphate metabolism
cit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102615443
   00562 Inositol phosphate metabolism
    102615443
Enzymes [BR:cit01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     102615443
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     102615443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 102615443
NCBI-ProteinID: XP_006486263
Position
7
AA seq 497 aa AA seqDB search
MKKATASFMLILCVLLLTHLNDAVQNFDVRRHLSTVSRYDFVKDVVDKNFVPSEIPDGCT
PIHLNLVARHGTRAPTKKRMRELERLADHLEVLIREAKEKGSSLQKVPGWLQGWKSPWQG
KLKGGELISKGEDELYDLGIRIREKYPDLFSEEYHPDVYPIKATQVPRASASAVAFGMGL
FNERGTLGPGRHRAFAVTSESRASDIKLRFHDCCDNYKDFRISQAPAVERLKEPILDEIT
SSIARQYELNFTRQDVSSLWFLCKQEASLLDITDQACGLFSPSEVALLEWTDDLEVFILK
GYGKSLNYRMGVPLLEDIVQSMEQAINAKEEKHTSGNYEKARLRFAHAETVIPFTCLLGL
FLERSEFQQIQKEEPLALPPKPPQSRNWRGSILAPFTGNNMLVLYSCPANSSDKYFVQVL
HNEHPTSMPGCNGTDFCPFDVFKERIVAPHLKYDYNTLCNVQTEQAIHKSKTSKLSLLLR
WLFPRWNDDTQSHKVEL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagctacggcttcttttatgttgatcctgtgcgtacttttgttgacgcatcta
aacgacgccgttcaaaatttcgacgttcgacggcacctctcgactgtctcaagatacgac
ttcgtaaaagacgtcgttgataagaactttgtaccttctgaaattcccgatggatgtact
ccaattcacttaaatcttgtggcaaggcacgggactcgtgcacccacgaagaaacggatg
agggagttggaaagattggctgatcatttggaagtacttataagggaagccaaagaaaag
ggttcgtctttacagaaagttccgggctggttacagggatggaagtctccctggcaaggg
aaactgaagggtggtgaattgattagcaaaggagaagatgagttatatgatctcggaatc
aggattagagaaaaatatccagatttgtttagcgaggaatatcacccggatgtctatccc
attaaggctactcaggttcctcgcgcatctgcgagtgcagtagcatttggcatggggctc
tttaacgagagagggactctaggacctgggcgccatcgagcatttgctgttacaagtgaa
agccgtgcaagtgatataaagctgaggtttcatgattgttgtgacaactacaaggatttt
aggataagtcaggcccctgcagttgagaggcttaaggaaccgattcttgatgaaattacc
tcttcgatagcaaggcaatatgaactgaatttcacaagacaagatgtttcctctctttgg
ttcttatgtaaacaggaagcatccttgttggatataactgatcaagcttgtggcctcttc
agtccttctgaggttgctttgctggagtggacagatgacttagaggtgtttatattgaag
ggttatggtaaatcattaaattatcgaatgggagttcctctgcttgaggacattgttcaa
tcaatggaacaagctattaatgctaaagaagagaaacatacttctggaaattatgaaaag
gcgagacttcggtttgcacatgcagaaactgtgattccttttacttgtttgcttggactt
ttccttgaaagatctgaattccaacaaatacaaaaggaagaacccttggcactcccgcca
aagcctccccagagtagaaattggagaggcagcattctggcaccctttactgggaataac
atgctggttctgtacagctgtcctgccaactcttccgacaagtactttgtacaagtattg
cacaatgaacatccgacttcaatgccaggttgcaatggtacagatttctgtccatttgat
gtttttaaggaaagaattgttgctccacatttaaagtatgactacaatacgctctgtaat
gttcagacggaacaagccatacataagtctaaaactagtaagttgtcactactgcttcgt
tggctgttcccacggtggaatgatgatacccaatctcacaaagtagagttgtag

DBGET integrated database retrieval system