KEGG   Citrus sinensis (Valencia orange): 102616261Help
Entry
102616261         CDS       T02983                                 

Definition
(RefSeq) geranylgeranyl pyrophosphate synthase, chloroplastic-like
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00900  Terpenoid backbone biosynthesis
cit01100  Metabolic pathways
cit01110  Biosynthesis of secondary metabolites
Module
cit_M00366  C10-C20 isoprenoid biosynthesis, plants
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    102616261
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:cit01006]
    102616261
Enzymes [BR:cit01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     102616261
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     102616261
    2.5.1.29  geranylgeranyl diphosphate synthase
     102616261
Prenyltransferases [BR:cit01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   102616261
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 102616261
NCBI-ProteinID: XP_006471033
Position
3
AA seq 366 aa AA seqDB search
MSLILPPSSVSMASSELYRNSINAHKHHSMIAFDHAKHVTNSHPAKSILMGRQPKKLKII
NSQRNDTLPKLFQVDEYKALKAKQINKALDEAVPLRHPAILHEAMRYSLIPGGKRFMSTL
CIASCELVGGSESVAMSLACAIEMLSTMGTIQDDLPCFDNDDLRRGKPSNHKVFGEATTI
LACQALHCLAVEQIAMMKTKNVSPDRLLRAIVEMSSAIGSEGLAAGQIMDISSEGKDVSL
SELNFIHRHKSEKFVEASIVSGVIIGGGNEEEIERMRNYGKCVGMAYQLWNDIVDVIGSP
ETKETTGRDMLRGKATYPKLVGIDKSKNYAKELLAKAKQELAYFDPAKAAPLDHLVNFMV
SFDNVN
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaatccttcccccaagctccgtatccatggcctcatcagagctctataggaac
tccattaatgctcacaaacaccactcaatgatcgcatttgaccacgctaaacatgttacc
aattcccaccctgcaaaatcaatactgatggggcgccaacccaaaaaactgaagatcatt
aattcacaacgaaacgacactttgcctaagttattccaagttgacgaatacaaggccttg
aaagcaaagcaaatcaacaaggctttagatgaagcagttccactgcgacatcctgctatt
cttcatgaagcaatgagatactctctgatacctggtggtaaacgttttatgtcaacttta
tgcattgcttcatgcgagctggttggtggaagtgagtcagtggcgatgtcactggcttgt
gctattgagatgctttctacaatgggtacgattcaagatgacctgccttgctttgacaac
gatgatcttcgacgaggcaagccttcaaaccacaaggttttcggtgaagcaaccacaatt
cttgcttgtcaagctctgcactgccttgccgttgagcaaattgcaatgatgaagaccaaa
aacgtttcgcccgaccgccttcttcgagccattgttgaaatgagctcagcaattgggtca
gaaggacttgctgcagggcagatcatggacatcagcagtgaaggcaaagacgtaagtttg
agtgaattaaacttcatccatagacacaaatccgagaaatttgtagaggcaagcatagtt
agtggagtcataataggaggaggaaatgaagaagagatagagagaatgaggaactatgga
aaatgtgtagggatggcatatcaattgtggaatgatattgtagatgtgattggatcgcca
gagacgaaggaaacaactggtagggatatgctgcgaggtaaagcaacgtatccaaagttg
gtggggattgacaagtccaaaaattatgccaaggagcttctagcaaaagcaaaacaagag
cttgcttactttgatcctgcaaaagctgccccactagaccatctggttaacttcatggtt
tcttttgacaatgttaattag

DBGET integrated database retrieval system