KEGG   Citrus sinensis (Valencia orange): 102616460Help
Entry
102616460         CDS       T02983                                 

Definition
(RefSeq) glutamate--tRNA ligase, cytoplasmic
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00860  Porphyrin and chlorophyll metabolism
cit00970  Aminoacyl-tRNA biosynthesis
cit01100  Metabolic pathways
cit01110  Biosynthesis of secondary metabolites
Module
cit_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    102616460
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    102616460
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cit01007]
    102616460
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cit03016]
    102616460
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:cit02048]
    102616460
Enzymes [BR:cit01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     102616460
Amino acid related enzymes [BR:cit01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   102616460
Transfer RNA biogenesis [BR:cit03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    102616460
 Prokaryotic type
   Other AARSs
    102616460
Prokaryotic defense system [BR:cit02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    102616460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1c tRNA-synt_1c_C GST_C_3 GST_C GST_C_2 tRNA-synt_1e GST_C_6
Motif
Other DBs
NCBI-GeneID: 102616460
NCBI-ProteinID: XP_006470964
Position
3
AA seq 722 aa AA seqDB search
MTMEIKVLSFPADSPPLLVIAAAKLAGITIPTETSGSAPTFSFSNGSKLQGTYVLLRYIG
RVGNFYGQNAYEAGEIDEWLDYTPVFSSGSEFENACTYVDKYLERRTFVVGHSLSIVDIA
IWSALAGTGQRWDSLRKSKKYQNLVRWFNSLSAEYSDSLDEVTATYVSNRGLGKPTAAKS
KEQQGVKGDVSEKGKAGSRPSFEVDLPDAEIGKVRLRFAPEPSGYLHIGHSKAALLNQYF
AQRYQGQLIVRFDDTNPAKESNEFVDNLLKDIETLGIKYETVTYTSDYFPDLMEMAENLI
RQGKAYVDDTPREQMQKERMDGIESKCRNNSIEENMKLWKEMIAGSERGLECCLRGKLDM
QDPNKSLRDPVYYRCNPIPHHRIGSKYKVYPTYDFACPFVDAKEGITHALRSSEYHDRNA
QYYRIQEDLGVRKVHIYEFSRLNMVYTLLSKRKLLWFVQNGKVDGWDDPRFPTVQGIVRR
GLLVEALIQFILEQGASKNLNLMEWDKLWTINKKIIDPVCPRHTAVIEDRRVLLTLTDGP
DKPFVRIIPRHKKYEGAGEKATTYTKRIWIDHADAQLISANEEITLMDWGNAIVKEISRD
QDGNVTQLSGFLHLEGSVKTTKLKLTWLPETNELVNLTLVGFDYLITKKKLEEGEDFLDV
LNPCTRFETAAIGDSNMRNLKRGEILQLERKGYFRCDVPFTRSSKPVVLFAIPDGRQQAV
FK
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgactatggagattaaggtgttatcttttccggccgacagccctccactattggtcatt
gctgctgccaagcttgcgggaatcacgataccaactgaaacatcaggctctgctcctacg
ttttctttctcaaatgggtcaaaattgcaaggaacttatgttctcctccgttatatcggt
cgtgttggtaatttctatggtcagaatgcatatgaagctggtgagattgatgagtggctg
gattatactccagtcttttcatctggttccgaatttgaaaatgcatgcacctatgtggat
aagtatcttgagagacgtactttcgtagttggccatagtttatcaattgtggacatagct
atctggtcagctcttgctggaactgggcaaagatgggatagtttaaggaaatcaaaaaag
taccagaatctagtgcgttggttcaactcgttatctgcagaatatagtgattctttggat
gaagtgacagcaacatatgtcagtaatagagggttgggaaagccaactgcagccaagtca
aaagaacaacagggtgtgaaaggggatgtatctgagaagggaaaagctggcagccgtcct
tcttttgaagtggatcttcctgatgctgaaattggcaaagtgcgtttgcgatttgctcca
gaaccaagtggttatcttcacatcgggcactcaaaagcagctctactgaaccagtatttt
gctcaacggtaccaaggtcagctgattgtgcgttttgatgacacaaatcctgctaaagaa
agcaatgaatttgtggacaatcttcttaaagatattgagacattgggcatcaaatatgaa
acagtaacctacacttcagactactttcctgatttgatggaaatggctgagaatttgatt
cgtcagggcaaggcttatgttgatgacacgcctcgtgagcaaatgcagaaagaaaggatg
gacgggatagaatcaaaatgcagaaacaacagcattgaggagaatatgaaattgtggaaa
gaaatgattgcaggatctgaaaggggtttggagtgctgtcttcgtgggaagttggacatg
caagatcccaacaaatctcttcgagatccagtctattatcgttgcaatccgattccccac
catcgaattgggtccaagtacaaggtatacccaacatatgattttgcttgtccttttgtt
gatgctaaagaaggaataacacatgcactcagatctagtgagtaccatgatcgcaatgca
cagtactataggattcaggaggatctgggtgtaagaaaggttcatatttatgagtttagc
agattgaacatggtgtatacacttctcagcaagcgcaagcttctctggtttgtacaaaac
ggaaaagttgatggatgggatgatcctcggtttcctactgtccaaggaattgtgcgtagg
ggtctgctggttgaggctttgatccagtttattcttgaacagggtgcttcgaaaaatctt
aatcttatggaatgggacaaactttggaccattaataagaagatcattgatcctgtttgt
cctagacatactgctgtcattgaagacagacgtgtactgctgactctaaccgatggccct
gataaaccatttgtgcgcataattccaaggcataagaagtatgaaggtgcaggagaaaaa
gctacgacatacacaaaaaggatatggatagaccatgctgatgctcagctgatttctgcg
aatgaggaaattactttaatggattgggggaatgccatagtaaaagaaattagtagggac
caggatggaaatgttacacaattatcaggatttttgcatcttgaaggatctgtcaagacc
acaaagttgaagctcacatggctacctgagacaaatgagttagttaacctcacattggtt
ggctttgactatctaatcacaaagaagaagctggaagaaggagaggacttccttgatgtg
ctcaacccctgtacaagatttgagactgcagctattggagattcaaacatgcggaatctg
aagcggggagagattttgcaactggagaggaagggctacttcagatgcgatgttcctttt
accagatcttcaaagccagtggttctctttgcaatcccagatgggcgccagcaagcagtc
tttaagtaa

DBGET integrated database retrieval system