KEGG   Citrus sinensis (Valencia orange): 102617478Help
Entry
102617478         CDS       T02983                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00970  Aminoacyl-tRNA biosynthesis
cit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cit00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    102617478
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cit03029]
    102617478
Enzymes [BR:cit01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     102617478
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     102617478
Mitochondrial biogenesis [BR:cit03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    102617478
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-GeneID: 102617478
NCBI-ProteinID: XP_006475983
UniProt: A0A067GMN3
Position
4
AA seq 152 aa AA seqDB search
MGSRGLLLLKGAAPKHHIFNNTKGSIFSSKMPTRYYYYDYDYNNRTRNCSTTTTRSSLEP
PDVPRLAQTARISLTPHEVEEFAPKIRQVIDWFGQLQDVDLDSVDPALRADSETGYLRED
IPKTFKNRESMIAAVPSYDEPYIKVPKVLNKE
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggggagcaggggtttgcttctgctgaaaggagcagcgccaaagcatcacatttttaac
aacacaaaagggagtattttttcctcaaagatgcccactcgttattattattatgattac
gattataataacagaaccagaaactgctcaacaacaaccacaaggtcctctcttgaacct
ccagacgtgcctcgtttggcgcaaactgctcggatctctctcacccctcatgaggttgaa
gaatttgctcccaaaattcgacaagttatagactggtttggacaactccaagatgttgat
ctcgacagtgtcgatcccgcccttcgagcagattctgagactggctatttgagggaagac
attcccaaaacattcaagaacagggaatccatgatagctgctgttccaagctatgacgag
ccttatatcaaagtgcctaaagtcttaaacaaagagtaa

DBGET integrated database retrieval system