KEGG   Citrus sinensis (Valencia orange): 102618875Help
Entry
102618875         CDS       T02983                                 

Definition
(RefSeq) arginase 1, mitochondrial
  KO
K01476  arginase [EC:3.5.3.1]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00220  Arginine biosynthesis
cit00330  Arginine and proline metabolism
cit01100  Metabolic pathways
cit01110  Biosynthesis of secondary metabolites
cit01230  Biosynthesis of amino acids
Module
cit_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102618875
   00330 Arginine and proline metabolism
    102618875
Enzymes [BR:cit01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     102618875
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-GeneID: 102618875
NCBI-ProteinID: XP_006490894
UniProt: A0A067H1S1
Position
Unknown
AA seq 339 aa AA seqDB search
MSAMIGKRGVHYLQKLKSANIPIAVIEKGQNRVIDASLTLIRERAKLKGELVRALGGAVA
STSLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSTTEEGKELNDPRVLTDVGDVPVQ
EIRDCGVDDDRLMNVITESVKLVMEEDPLHPLVLGGDHSISFPVIRAVSEKLGGPVDVLH
LDAHPDIYDAFEGNKYSHASSFARIMEGGYARRLLQVGIRSITKEGREQGKRFGVEQYEM
RTFSRDRQFLENLKLGEGVKGVYISVDVDCLDPAFAPGVSHIEPGGLSFRDVLNILHNLQ
ADVVAADVVEFNPQRDTVDGMTAMVAAKLVRELTAKISK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaatgataggaaaaagaggagttcattacctgcaaaaattaaagtctgcgaat
atcccaattgctgtgatagaaaaaggtcagaatcgtgttattgacgcttctcttaccctt
attcgtgaaagggcaaaacttaagggagaacttgtgcgtgctttgggaggtgctgtggca
tcaacgtcacttcttggagttcccttaggacacaactcgtcatttcttcaggggccagca
tttgcgcctcctcggattagagaagccatttggtgcggcagcactaattcaacaactgaa
gaagggaaagaattaaacgacccgcgggtgctaacagatgtcggtgatgtccctgtccaa
gaaattcgagattgtggagtagatgatgatagattgatgaatgtcataactgagtctgtc
aagctggtcatggaagaggatccattgcatccactagttttaggtggtgaccactcgata
tcttttcctgttataagagctgtctctgagaagcttggaggacctgtggatgttcttcat
ctggatgcccatcccgatatctatgatgcctttgagggaaacaaatactcacatgcatca
tcttttgcccgaatcatggaaggtggttatgctaggcggttattgcaggtcggaatcaga
tcaataacaaaagaaggccgagaacagggcaagaggtttggagtagagcaatatgaaatg
aggaccttttcaagagatcgccaatttttggagaacctgaaacttggggagggtgtaaag
ggtgtgtacatctcagtagatgttgactgtcttgatcctgcctttgctcctggagtatca
cacatagagcctggaggtctctctttccgtgatgttttaaacattctccacaatcttcaa
gctgatgttgttgctgctgatgtggttgagttcaacccacagcgtgacactgttgatggg
atgactgcaatggttgctgctaagttagttagggaactgacagcaaagatctcgaaatag

DBGET integrated database retrieval system