KEGG   Citrus sinensis (Valencia orange): 102624960Help
Entry
102624960         CDS       T02983                                 

Definition
(RefSeq) beta-hexosaminidase 2-like
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00511  Other glycan degradation
cit00513  Various types of N-glycan biosynthesis
cit00520  Amino sugar and nucleotide sugar metabolism
cit00531  Glycosaminoglycan degradation
cit00603  Glycosphingolipid biosynthesis - globo and isoglobo series
cit00604  Glycosphingolipid biosynthesis - ganglio series
cit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    102624960
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    102624960
   00531 Glycosaminoglycan degradation
    102624960
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    102624960
   00604 Glycosphingolipid biosynthesis - ganglio series
    102624960
   00511 Other glycan degradation
    102624960
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cit03110]
    102624960
Enzymes [BR:cit01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     102624960
Chaperones and folding catalysts [BR:cit03110]
 Intramolecular chaperones
  Others
   102624960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b Phage_connector
Motif
Other DBs
NCBI-GeneID: 102624960
NCBI-ProteinID: XP_006492777
Position
Unknown
AA seq 596 aa AA seqDB search
MARAIIFFISLSQLCLLSLQSDPINVWPKPRIFSWPKPEATSLAAEFKIQAPMQTQLSSA
VDRYLKLIKSEHHHHLVRPSINISSSPPLQTLSISVDNISVPLTHGVNESYSVTITSDEN
TAYLVASTVWGAMRGLETFSQLVWGNPSCVAVGIYVWDEPLFSHRGLLLDTSRNYYEVDD
ILRTISAMSANKLNVFHWHITDSHSFPLLLPSDPNLAAKGSYGEDYLYTPSDVKKIIEYG
LDYGVRVVPEIDTPGHSGSWAGAHPEIVSCANKFWWPAGTKWEDRLASEPGTGQLNPLHP
KTFGVMINVLENVASIFPENFFHSGGDEILPACWKSDSLIQSFLSTGGTLSEVLEKFINF
VFPFIVALDKTAIYWEDVILDNEIKVDPSYLYPEYTIFQSWKNGTESTKKIVQAGYRVIV
SSSDYYYLDCGHGGFLGNDSLYDQPPEIQKAAGGGSWCSPFKTWQTVYNYDITEGLTEEE
KELVLGGEVALWSEQADGTVLDARLWPRTSAMAEALWSGNRDETGKKRYAEATDRLNEWR
HRMVNRGIGAEPIQPLWCLQNPGMCNTVHAYNSGDDEENVTLSTGSADFKGFADSS
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggcaagagccattatcttcttcatcagcctttctcaactttgcctcctgtctttgcaa
tctgatcccatcaatgtctggccgaaacccagaatcttctcatggccaaaaccagaagcc
acctctcttgctgcagagttcaaaatccaagccccaatgcagacccagctctcctctgcc
gttgaccgttacctcaaactcattaagtcagagcaccaccatcacttggttaggccatcc
atcaacatttcatcatctcctcccctacagaccctctccatatctgttgacaacatttct
gtccctcttacgcacggtgttaacgagtcctactctgtcaccatcacctccgacgaaaac
acagcttacctcgtagcctcgactgtatggggcgccatgcggggcctggagaccttctcc
cagctggtctgggggaatccgtcgtgtgtggcggttggcatttatgtgtgggatgagcca
ctcttttcgcatagagggttgttgcttgatacctcgaggaactattatgaagttgatgat
atactgaggacaatttctgcaatgagtgcaaataaattgaatgtgtttcattggcacatt
acggattcacactcgtttccattgttgctgccgtctgatcctaatcttgccgccaaggga
tcctatggggaggactacttgtacactcctagtgatgtgaagaagattattgaatatggt
ttggattatggtgtcagggttgttccggaaattgacactcctggccactcaggatcatgg
gcaggagctcacccagagatagtgtcctgtgcaaacaaattttggtggccagctggcacc
aaatgggaagacaggcttgcttccgagcctggaaccggacaacttaatcccttgcaccca
aaaaccttcggggtcatgataaatgtcctggagaatgttgcaagcattttcccggaaaat
tttttccattcaggaggcgatgaaatccttccggcttgctggaaatccgattccttgatc
caatccttcttatccaccggcggtaccctcagcgaagtcctggaaaaattcatcaatttt
gtctttccgttcattgttgctcttgacaagactgcgatttactgggaagatgtgatcctg
gataatgaaattaaagttgatccatcgtatctttatcctgagtacaccattttccaatcc
tggaagaatggtactgagagcaccaaaaaaattgtgcaagctgggtacagggtgattgtg
tcatcgtccgactattattacttggattgcggacacgggggattcctcggaaatgacagt
ttgtatgatcagcctccggagattcagaaagccgcaggcggagggtcctggtgctcccca
tttaaaacgtggcaaacggtttacaattatgacattacggaagggttgaccgaggaggag
aaggagttggtgctgggcggggaggtggcgttgtggtcggaacaggctgatgggacggtg
ctggatgccaggctgtggccgaggacttcggctatggcggaggccttgtggtccggaaac
agggatgagacggggaagaagaggtacgccgaggcgacggaccggctgaacgagtggagg
cataggatggtgaatagagggatcggagctgagcctattcagccactgtggtgcttgcaa
aatcccggaatgtgtaacactgttcatgcatataattcgggggatgatgaagaaaatgtg
acactttctacgggttctgcggattttaagggttttgctgattcttcttga

DBGET integrated database retrieval system