KEGG   Citrus sinensis (Valencia orange): 102625579Help
Entry
102625579         CDS       T02983                                 

Definition
(RefSeq) glutathione S-transferase 2 isoform X1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00350  Tyrosine metabolism
cit01100  Metabolic pathways
Module
cit_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    102625579
Enzymes [BR:cit01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     102625579
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 Tom37 GST_C_3 GST_C_2 DUF5060
Motif
Other DBs
NCBI-GeneID: 102625579
NCBI-ProteinID: XP_006490921
UniProt: A0A067H1U9
Position
Unknown
AA seq 233 aa AA seqDB search
MDADTNNDDQIDIGINSSSSSKLVLYSYWQSSCSWRVRFALKLKGLIYEYKAVDLSKGEQ
FSPEFEELNPLHFVPVLVDGDVVVSDSYAILLYLEEKYPQRALLPAADPQQRALNLQAAS
IISSSMQPLHMLSLLKYIEDKFGPDERLLWVQTHIEKGFLALEKLLIDFAAKYATGEDVY
MADVFLAPQIAVVTMRFNIDMSKFPTLLRIYESYKGLPEFLASSPERQPDAAR
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggacgcagacaccaacaacgatgatcagatagatattggtattaattcgtcgtcgtct
tcaaagcttgtattatactcgtactggcagagctcttgctcttggcgggtccgcttcgct
ttgaaacttaaaggtcttatctatgaatacaaagccgtggacctttcaaaaggggaacaa
tttagtcccgagttcgaggaattaaatcctctgcatttcgttccggtgttagttgatggt
gatgtcgtggtctcagattcctatgcaatcttgttgtatttggaggaaaagtatcctcaa
agagctctcttacctgctgctgatccacagcaaagagctttgaatctccaggctgccagt
ataatcagctctagcatgcagcctcttcatatgctatcattgctgaaatatattgaggat
aagtttggtcccgatgagcgacttttatgggttcagactcacatagaaaaaggtttccta
gctcttgagaagttgctgatagattttgctgccaagtatgccacaggagaagatgtgtac
atggctgatgtgtttttggccccacaaattgctgttgttactatgaggtttaacattgac
atgtccaagtttccaactttactcaggatatatgagtcatataaaggcttaccagaattc
ctagcctcatcaccagagagacagccagatgcagcgcgttaa

DBGET integrated database retrieval system