KEGG   Citrus sinensis (Valencia orange): 102627058Help
Entry
102627058         CDS       T02983                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00480  Glutathione metabolism
cit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102627058
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cit02000]
    102627058
Enzymes [BR:cit01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102627058
Transporters [BR:cit02000]
 Other transporters
  Pores ion channels [TC:1]
   102627058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_N_4 DUF2150 GST_C_6
Motif
Other DBs
NCBI-GeneID: 102627058
NCBI-ProteinID: XP_006494138
Position
Unknown
AA seq 220 aa AA seqDB search
MAEVKLHGTLLSPFVYRVIWALKLKGVPYEFVAEDLSNKSALLLKHNPVHKKIPVLVHGG
KPVCESMVILEYIEETWPQNPLMPNNPYDRALARFWIKFAEDKGVAVWKMFRSTGQELQN
TMKEALEMLQTVEEHGLGEKKFFNGDNIGLVDLAFGSIVYWLQVIEDIVGAKLFESHKFP
HLHAWIETFKQVTLIEENLPNQDELLVALKLRREQLMASA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtgaagcttcatgggaccctgctgagtccatttgtttacagggtgatttgg
gctctgaaattgaaaggcgtgccatatgaatttgttgcagaagatctctcaaacaaaagt
gctttgcttttgaagcacaatccggttcacaagaagatcccagtgcttgtccatggcgga
aaaccagtttgtgagtccatggttattctcgaatacatcgaagagacgtggccacagaat
cccttgatgccaaataatccttatgatagagctcttgctcgattctggattaaattcgcc
gaagacaagggtgttgctgtttggaaaatgtttcgtagcactggacaagaactacaaaac
acaatgaaggaagccttggaaatgctacaaaccgttgaagagcatggcttgggagagaag
aaatttttcaatggagacaatattggcttagtggacctagcgtttggttcaattgtttat
tggttgcaagtcattgaagatatagtgggcgctaaactatttgaatcacacaaattccct
cacttgcatgcctggattgaaactttcaagcaagtcactttgattgaagaaaatcttcct
aatcaggatgaactattggttgctctcaaacttcgtcgtgaacagttgatggcttctgct
tga

DBGET integrated database retrieval system