KEGG   Citrus sinensis (Valencia orange): 102627230Help
Entry
102627230         CDS       T02983                                 

Definition
(RefSeq) separase isoform X5
  KO
K02365  separase [EC:3.4.22.49]
Organism
cit  Citrus sinensis (Valencia orange)
Brite
KEGG Orthology (KO) [BR:cit00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cit01002]
    102627230
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cit03036]
    102627230
Enzymes [BR:cit01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     102627230
Peptidases [BR:cit01002]
 Cysteine Peptidases
  Family C50: separase family
   102627230
Chromosome and associated proteins [BR:cit03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    102627230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 102627230
NCBI-ProteinID: XP_006491875
Position
Unknown
AA seq 2215 aa AA seqDB search
MATASTESSLLAKLEASDSTPIYSLFADYLRPFSDLQNDNTKPNPKSKPKAKPNQNLIRP
LAKKFLTFLNNSITILPKRLSNLQCKDDHQTLVDELYDTYRLCLNCLELISSQLACKPYT
IQLQRVRFVCCLVASGKGEDAVREGLRVLETLRRMDFEGKCGDSEFGKVFVEAVAAIVQC
AAVGRSKDCEVYRRVLGLFQEAKCWFRVLDANAYAKLHRVLVSYLGKCTQHLVEEIMCFN
RDLVREFCEATLTEYAKSSMKDQFYKFCRRLCFTLFSLQESKPSLIIEIILCVLDSIACQ
CKQVESDNTGIELVELVSYCANKCRTAGTIFCSTVAGHLNHIGGHFPQVITPVDLILRLY
ATGLYLTNYEVKFRGGDLTSTRAAKDEFVLSCLPDDGDQLHNLASLLSALGSYFSFCCAK
NFVSSSVECEDSISQLHLQPDSESSITSMQKNREAYMLSYLNALKFLCFPLAEQVNLEKK
ELVSEIEAAYISPQLCSIQDAFYQFFDVFFSQSLASERKRDGLDDNKRILSVTVAAFILS
ITMDCKLKKTVLLIKHIIANEWIQPEGLKYLYASLYNIGVLLYRNKQVKEASKALKLCCR
AAWACVARLSQMFACNCNSDGFHGGMTEGAIVDFVNEACTRSAFLLDVLHHRGSQKMEKV
IVDSLENWSIAAILFKTLPGPLPLVKQWVKIECKRRKNLDVEDDAPTLYYLLSSSGKASE
RTIGIILEQELHSYEELYPLSPELCQRMQMKISTILLQSVYNSRNSYFQRSRILLRKGRA
LRARGTEGLKDCIQCLSEAICVMNDISGDMSQHETLHCHQLAVAYCLRALCTQEAEPNSK
QVIEDIGAALNLWLSVSICFESERCNMVSENTMLLLYNVVDLLSLKGFIEFHNNIYKLML
RLFKCKNVPLEKYLSILWESRRLSHALCISPVNDAFLVNLAEQCGELSKSIEFWMGCLRG
SQPLLVGFQQSLLFLFANSSHGCYISKSSVQPCITIHDVKEAASELISSVPVTPRSVFLV
GYLYYDLCERLIANGRLLEALSYAKEAHRLRTQLFQEKFSYSVENSVKEYNDAGDISQKL
HSSPKGFKPSSSVASEVWSFDASSWNVDGCYLSPWNVLQCYLESVLQVGIIHELVGNGVE
AEAFLLWGKSISCTQSLPQFIVAFSSILGKLYRKKQLWDQAEKELKNAKQILVEKSINLS
CLKCRLILEVTVDQQLGDLSRSYSGCDDRGNTLIERLSNAEKLYKSALDKLNLSEWKNSI
SLPEEARSESILPKKPSIQNVEHGAGNTFVHSTLHQPDTVELTARNQLSSKVGGTKCRKT
KNALKSLVNDQNLDLDPNSRITRSKYRSSQNQSVNNCVEERSGVSKHAKNNNLSDLPDIL
SQGKSVLEAKSFVDTAYQAACICNKMKCWQCLPGEVIESGLLDNLLHVKWEFTRRRLSLR
VLAGIGKCFGNRDQTHEAHKIVVQSVSVLLCRNSFSHTDSSLPLTVLLDLIGKEYSEDVF
AVERAGVLYNLCWFSLKGYRSMKSRNSCCDLSHLQFQKLVSWLMLAFVLCREAPILFQKV
SKLLAVIYVLSSTSKLFSLSSSSKVLSESHWASFFHQASLGTHLNYKFLSNMSWRFKAQD
IVDTEASHVTGSSCINTEAGKLIRISPESIKDLEQFVKDFLLSLPCTTVICVTLLGGAYT
SLLQELLPLPSCVHAWMMLSRFNSINQPIVVLLPVNAVLQEDADYDDDGAITSFRELREI
KDCGKNWHCPWGSTIADDVAPAFKLIMEDNYLSSRSSYGDSLGQRSLWWNRRTNLDQRLC
EFLRKLEDSWLGPWKYMLLGEWSNCKNLDTVHKKLVRDLKCKCKANINESLLRIVLGGLK
GAFKGEECIAQLCFKKGCYVGTVGYSDNSSCGTSSEASNGVERLSELALQLIHEAVDELE
EDSGHREPTILVLDCEVQMLPWENIPILRNHEVYRMPSVGSIAATLERIHRHEQLVKGLL
ATFPLIDPLDAFYLLNPSGDLSETQLLFEDWFRDQNLVGKAGSAPTAEELTLALKSHDLF
IYLGHGSGSQYISRHDLLKLEKCAATFLMGCSSGSLSLNGCYIPQGTPLSYLLAGSPVIV
ANLWDVTDKDIDRFGKTMLDAWLRERSSVPVGCDQCSSVQDEAKNGRGKVNKKRMSRKKL
PETSDISLCNNGCDHRPKLGSFMGQAREACKLPFLIGAAPVCYGVPTGIRRKPSL
NT seq 6648 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgcttctaccgaatcctctctcctcgccaaactcgaagcctccgattcaact
ccaatctactctctcttcgccgactatctccgcccgttctcagatctgcaaaacgacaat
acaaaaccaaatccaaaatcaaaaccaaaagcaaaaccgaatcaaaacctaatccgtcca
ctcgccaagaaattcctcacattcctcaacaactccatcaccattctccccaaacgcctc
tccaatttacaatgcaaagacgaccaccaaaccctagtcgacgagctctacgacacctac
aggctttgcttgaactgcctggagttaatctcgtcgcagttggcgtgcaagccgtacacg
attcagttgcagagggtgaggttcgtgtgttgccttgtggcgtcggggaagggcgaggat
gccgtgagggaggggcttagggttttggagacgcttagaaggatggattttgaagggaag
tgcggtgattcggagtttggtaaggtgtttgtggaggctgtggccgcgatagttcagtgt
gcggccgtgggacggagtaaggattgtgaagtttataggagagtgcttggcttgttccaa
gaggctaagtgttggttcagggtattagatgcaaatgcgtatgcaaagttgcacagggtg
cttgtgtcctatctggggaaatgcactcaacatttggttgaagagatcatgtgttttaat
agagatttggtacgtgaattctgtgaggcaacattgactgagtatgcaaagtcatcaatg
aaagatcaattttacaagttttgtcgtcggctgtgcttcactctgttctcactgcaggag
agtaagccctctcttatcattgaaataatactttgtgtgttggactccattgcctgtcaa
tgcaagcaggtggaatcggataatactggaatagagctggttgaacttgtctcttattgt
gccaacaaatgtcgcactgcaggtacaattttttgcagtaccgttgcaggacatctgaat
cacataggtggtcactttccccaggttataacacctgttgatttgattctgaggctttat
gctactgggttgtacttgaccaactatgaggttaagtttagaggtggtgatttaacatcc
accagagctgcaaaagatgagtttgtgcttagttgtttgcctgatgatggggatcaactg
cacaatttagcttctttgcttagtgcattgggaagttacttttctttttgctgcgccaag
aactttgtgtcatctagtgtggaatgtgaggattctatcagccaactacatttgcagcca
gattctgagtcctctataacttccatgcagaaaaatagagaagcttatatgctgtcatac
ttaaatgctttgaaattcttgtgctttccacttgctgaacaagtaaatttggagaaaaaa
gagttagtttctgaaattgaagctgcttatattagcccacagctctgcagcatacaggat
gcattttatcagttttttgatgtttttttctctcagagccttgcatctgaaagaaagaga
gatgggcttgatgataacaagagaatacttagtgtgactgtggctgctttcattctttcc
attacaatggattgtaaattgaagaagactgtgcttttgattaagcacatcattgctaat
gaatggattcaacctgaaggactaaaatatctatatgcctccctttacaatattggtgta
cttctgtacagaaataagcaagtgaaggaggcttcaaaggcattaaaattatgttgtagg
gctgcatgggcttgtgttgcccgtctatcccaaatgtttgcatgcaactgcaactcagat
gggttccatggtggcatgacagaaggtgctattgtagattttgtaaacgaggcatgtact
agaagtgcttttcttctggatgttctccatcatcgtggcagtcagaagatggaaaaagta
attgtagatagtctggagaattggtctattgctgcaattttgtttaaaacactgccaggt
cctttgcctttggtgaaacagtgggttaagatagaatgcaaacgtcgtaagaatttagat
gtagaggatgatgctccaactttatactatttgctgtcatcttctggaaaagcctcagag
aggacgatcggcattattttagagcaggagcttcattcatatgaagaattgtatcctttg
agcccagaattgtgtcaaagaatgcaaatgaaaatcagtaccatccttctgcaaagtgtg
tacaattcaaggaatagttattttcagagatcaagaattctactcagaaaaggtagggcg
ttgagggccaggggaactgaaggtctgaaggactgtattcagtgtttgtcagaggcaata
tgtgttatgaatgacatatctggagacatgtctcaacatgaaactttgcattgtcatcag
ttagcagtggcatactgcttacgagcattatgtacccaggaagctgaaccaaactctaag
caagttattgaagatattggggctgccctaaatctgtggttgagcgtatcaatttgcttt
gagagcgaacggtgcaatatggtctctgaaaatacaatgctactactctataatgtagtc
gatttattatcattaaagggtttcatcgaatttcacaataacatatataaactgatgctt
agattatttaagtgcaagaatgttccattggaaaagtatttgtccattctgtgggaaagt
agaaggctcagtcatgctctttgcatttcacctgtaaatgacgcattcctcgtgaactta
gcggagcaatgtggtgaactttccaagtctattgaattctggatgggctgtttacgggga
tcccaaccattactggttggattccaacagagtctcttatttttatttgctaattcttct
catggctgttacatttccaaaagttctgttcagccatgcatcacaatccatgatgttaaa
gaggctgcttctgagctcatctcaagtgttcctgtaacccctcgttctgttttccttgtt
ggatatctttactatgacttatgcgaaagactcattgcaaatggacgactgttggaggct
ctttcatacgctaaagaggcccatcgactacgtactcaactctttcaagagaaattttca
tactctgttgagaacagtgtcaaagagtacaatgatgctggggacatcagtcagaaacta
cattccagtcctaaaggtttcaaaccatctagttcagttgcaagtgaagtttggtctttc
gatgcttcttcatggaacgtagatggctgctacctcagtccatggaatgtgctacagtgt
tatcttgaaagtgtcctccaggttggaatcatccatgaattagttggaaatggagttgag
gctgaagcctttttactgtggggaaaaagcatctcttgcactcaaagtttgccacaattt
atagttgccttttcttctattttaggaaaattgtaccgtaagaaacagctttgggatcag
gcagaaaaggagcttaagaatgctaaacaaattttggtagagaaaagtataaatttatca
tgcttgaagtgtagattgattctggaagtgactgttgatcagcaacttggtgatctatca
cgaagttattctggttgtgatgatagagggaatactttgatcgaaaggctgtctaatgct
gaaaaactctacaaatctgccttagacaaattaaatctttctgagtggaaaaactcgatt
agtcttcctgaagaagctaggtcggagagcatactgcctaaaaaaccttctatacaaaat
gttgaacatggtgctggcaatacttttgtccattctaccttgcatcagccagatacagtg
gaacttacagcaaggaaccagttgagttcaaaggtggggggaactaagtgtagaaagact
aagaatgcactaaaatcgttggtaaatgatcaaaatttggaccttgatcccaattccagg
ataactcgttccaagtatcggtcttctcaaaatcaatctgttaacaattgcgttgaggaa
cgatcaggtgtttcaaaacatgctaaaaataacaatttatctgatcttcctgacattctt
agtcaaggaaagtcagtcttggaggcaaaaagttttgttgatactgcgtatcaagctgct
tgcatctgcaacaaaatgaagtgctggcaatgccttcctggggaagttattgaatctggg
ttgctagacaatttattacacgtgaaatgggagttcactcgcaggcgtctatcgttgaga
gtactcgctggtataggaaaatgctttggaaatcgtgatcagactcatgaggcacacaaa
attgttgttcaaagtgtatctgtcctcctgtgcagaaactcattttctcatactgactct
tctcttccactgactgtcttgcttgatttaattggtaaggagtactcagaagatgttttt
gctgttgaacgtgcgggagtactttacaacctttgttggttctctttgaagggttaccgt
tctatgaaatccaggaacagttgctgtgatctgtctcacttacagtttcagaaattagtt
tcttggttgatgctggcctttgtgctttgccgtgaggctcccattctttttcagaaggtt
tctaaactgctcgcagttatttatgtactctcttccacaagcaagctcttttctctgtca
tcttcctccaaagtactctctgaaagtcattgggcttctttttttcatcaagcttcactt
ggaactcatcttaattacaagttcttatcaaatatgagttggcgatttaaagcacaagac
attgtggatactgaggcctcacatgtaactggctcatcttgcatcaacacagaagcgggc
aaattaatcaggatttctcctgaatccatcaaagatcttgaacaatttgtaaaagatttt
cttttgagccttccttgcaccaccgtaatctgtgtgactttgctaggaggtgcttatact
agtttattacaagagttgctaccgctcccttcatgtgttcatgcatggatgatgttgtca
cgcttcaattctataaatcagcccattgttgtccttctaccagtaaatgcagtactacaa
gaggatgcagactatgatgatgatggtgcaattactagcttcagggaattgcgtgagatt
aaggattgtggtaaaaactggcactgcccctggggttccaccatagcggatgatgtagct
ccagcatttaaactaataatggaggacaactatttatcgtcaagaagttcctacggagat
tcactggggcaaagatcattgtggtggaaccggaggacaaaccttgatcagcgtctttgt
gaatttttaaggaaattagaggattcatggttgggtccttggaaatacatgcttctagga
gaatggtcaaactgcaagaacctggacacagtacataaaaaactggtccgtgatctgaaa
tgtaaatgcaaagctaacataaacgaaagccttcttagaattgttcttggaggtttgaag
ggtgcttttaaaggcgaggaatgtatagcacaactgtgcttcaagaaaggttgctatgtg
ggtacagttggatattctgataacagtagttgtgggacctcatctgaggcatcaaatgga
gttgaaagactttctgagttggcccttcaattaatacacgaagcagtggatgaactagaa
gaggactctggacatagagaacctactattctagtgctggattgtgaagtgcagatgcta
ccatgggagaatatacctatactgagaaaccatgaggtctatcgcatgccttctgttggt
agcatagctgcaactctggagagaatccaccgccatgaacagcttgttaaggggcttctt
gctacttttcctttgatagatcccttggatgcattttatttgttaaatcccagcggcgac
ctcagcgaaacacaacttctgtttgaggactggtttagagatcaaaatttggtggggaag
gctggatctgcacccacagctgaagaattgactctagccttgaaaagccatgacctcttc
atatatcttggccatggaagtggttcacaatacatttctaggcatgatcttctgaagctg
gagaagtgtgctgctactttcttgatgggatgcagtagtggttctttgtcattaaacggt
tgttacattccgcaaggtactcctctgtcctatctgctagccgggtcccctgtaattgtt
gccaacctttgggacgttacagacaaggacatagaccgttttgggaagaccatgcttgat
gcttggttaagggaaaggtcaagtgttcccgtgggctgtgaccaatgctcttcagttcaa
gatgaggccaagaacggaagaggcaaagttaacaaaaaaagaatgtcgcggaagaaatta
cctgaaacttcggatattagtttatgtaacaatggttgtgatcatagaccaaagcttgga
tcattcatgggccaagctcgtgaagcatgtaaactccctttcttgattggggctgcaccg
gtgtgttacggtgtcccaaccggtataagaagaaaaccaagtttatag

DBGET integrated database retrieval system