KEGG   Citrus sinensis (Valencia orange): 102627944Help
Entry
102627944         CDS       T02983                                 

Definition
(RefSeq) (-)-germacrene D synthase-like
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    102627944
Enzymes [BR:cit01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     102627944
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth
Motif
Other DBs
NCBI-GeneID: 102627944
NCBI-ProteinID: XP_006476905
Position
5
AA seq 554 aa AA seqDB search
MSIQVPQISSQNAKSQVMRRTANFHPSVWGDRFANYTAEDKMNHARDLKELKALKEEVGR
KLLATAGPIQLNLIDAIQRLGVGYHFERELEQALQHLYNEKYSDDDTEDDLYRISLRFRL
LRQHGYNVSCDKFNMFKDDKGNFKESLASDALGMLSLYEAAHLGVHGEDILDEAIAFTTT
HLKSVATHLSNPLKAQVRHALRQPLHRGLPRLEHRRYISIYQDDASHYKALLTLAKLDFN
LVQSLHKKELCEISRWWKDLDFARKLPFARDRMVECFFWILGVYFEPNYSLARRILTKVI
AMTSIIDDIYDVYGTPEELKLFTEVIERWDESSMDQLPEYMQTFFGALLDLYNEIEKEIA
NEGWSYRVQHAKEAMKILVEGYYDESKWFHENYIPKMEEYMRVALVTSGYTMLTTVSFLG
MDNIVTKETFDWVFSRPKIIRASEIIGRFMDDIKSHKFEQERGHAASAVECYMKQHGLSE
QEVCEELYRQVSNAWKDINEECLNPTAVPMPLLMRALNLARVIDVVYKEGDGYTHVGNEM
KQNVAALLIDQVPI
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtctattcaagttcctcagatttcgtcccaaaatgctaaaagccaggttatgcgacgg
acagcaaattttcacccaagcgtttggggtgatcgcttcgccaactacacagcagaggac
aagatgaatcatgcccgtgacttaaaagagctcaaagcactgaaggaggaagtgggaaga
aagctattagccactgctggtcctatacagctgaaccttattgatgctattcagcgcctg
ggcgtgggatatcactttgaaagagagttagagcaagcattacagcatttatacaatgaa
aaatattccgatgacgataccgaagatgatctctacaggatttcgcttcgatttcgcctt
ttaaggcagcatggctataatgtttcatgcgataaattcaacatgttcaaagatgacaaa
ggtaatttcaaggagtcattggcaagtgatgcgctaggaatgttgagcctgtacgaagca
gcgcatcttggagtgcatggagaagatatacttgacgaggccattgcttttacaaccact
caccttaagtccgtggcaacccatttaagcaatcctctgaaagcacaggttaggcatgca
ctgcggcagccgctgcacaggggactacccaggctagaacacaggcgttacatttctatc
taccaagacgatgcttctcattacaaagctttattaacacttgcaaagttggatttcaat
ctagtgcaatctttgcacaagaaggaactttgtgaaatctctagatggtggaaggatttg
gattttgccagaaagctgcctttcgcaagagaccgaatggttgagtgcttcttttggata
ttgggagtgtatttcgagcccaattattctcttgctagaagaatactaaccaaagtaatt
gccatgacatcaattatagatgacatctacgatgtatatggcactcctgaagagctcaag
ctctttacagaagtaattgagaggtgggatgaaagtagcatggaccaactccctgaatat
atgcaaacattttttggggcattattggatctttacaacgaaattgagaaagagattgcc
aatgaaggatggtcatatcgagttcaacatgcaaaggaagcaatgaaaattcttgttgaa
ggctattatgatgaatccaaatggttccatgagaattacattcctaaaatggaggagtat
atgcgtgtggcattagtgacctccggttacaccatgctcacaactgtatcttttttgggc
atggacaatatagtaacaaaggagacttttgattgggtgttcagtcgacctaagataatt
cgagcttctgaaataattggaagattcatggatgacataaaatcacacaagttcgagcaa
gagagagggcacgctgcctcggctgttgaatgctatatgaagcagcatggactctcagag
caagaggtttgtgaggagttgtataggcaagttagtaatgcatggaaggatataaacgaa
gagtgcctcaatcctactgcagttccaatgcctctgcttatgcgtgctttgaatcttgcg
agggttatagatgtggtttacaaggaaggcgatggatacacccatgtggggaatgaaatg
aaacaaaatgttgcagcattgctgatagatcaagttccaatataa

DBGET integrated database retrieval system