KEGG   Citrus sinensis (Valencia orange): 102628195Help
Entry
102628195         CDS       T02983                                 

Definition
(RefSeq) uncharacterized protein LOC102628195
  KO
K06195  ApaG protein
Organism
cit  Citrus sinensis (Valencia orange)
Brite
KEGG Orthology (KO) [BR:cit00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    102628195
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF525 UVR DUF4354
Motif
Other DBs
NCBI-GeneID: 102628195
NCBI-ProteinID: XP_006469662
Position
2
AA seq 289 aa AA seqDB search
MHAFNLSSINVSTEFNATRRRRCLSYNNSLDLEYGRRRRVGRGCKDLTRTYGIVACVGGG
GGGGGGGERLSSSARSFLSRSQAYALLKQQMEVAAKTEDYKEAARIRDSLRSFEEEEPIF
RLRRLMKEAVAEERFEDAARYRDKLKEIAPNSLLKCLSDATTLGIRVQVRSVYIEDRSQP
LKGQYFFAYRVRITNNSERPVQLLRRHWIITDANGKTENVLGVGVIGEQPVILPNTSFEY
SSACPLSTPAGRMEGDFEMKHVDRVGSQTFNVAIAPFSLSTMGDDSDSF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcttttaatttaagtagtattaatgtttctactgaatttaatgcgacgaggagg
aggagatgcttaagttataataattctttggatttagagtacggaaggagaagacgagtc
ggtcggggttgtaaagatcttacgaggacgtacgggattgtagcctgtgtcggcggcggc
ggcggcggcggaggaggaggagagagactgagttcgagtgcgaggtcgtttttgtctcgg
agccaagcttatgcactcttgaagcagcaaatggaggtcgctgccaaaactgaggattac
aaagaagcggcaagaattcgtgattcattgagatcatttgaggaagaggagccgattttt
cggcttcggaggttaatgaaagaggcagttgctgaggaaaggtttgaggatgctgctagg
taccgcgacaaattaaaggaaatagcaccaaactctctcttgaaatgtttgagtgatgca
acaaccttggggataagggttcaagttagaagtgtgtacattgaggaccgtagtcaacct
ttgaagggacagtactttttcgcatatagggtaagaattaccaataactcagaacgtcct
gttcaacttctcagacggcattggattatcacagatgcaaacggaaaaactgaaaacgtc
ttaggagttggagtcattggtgaacagccagttatacttcctaataccagttttgaatac
tcttcagcatgccctttaagcactccggctggcagaatggaaggtgattttgagatgaaa
catgttgatagagtaggttcacaaactttcaatgtggcgattgcaccattttctctatcc
acaatgggtgatgacagtgattctttttag

DBGET integrated database retrieval system