KEGG   Citrus sinensis (Valencia orange): 102629129Help
Entry
102629129         CDS       T02983                                 

Definition
(RefSeq) phosphoenolpyruvate carboxykinase (ATP)-like
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00010  Glycolysis / Gluconeogenesis
cit00020  Citrate cycle (TCA cycle)
cit00620  Pyruvate metabolism
cit00710  Carbon fixation in photosynthetic organisms
cit01100  Metabolic pathways
cit01110  Biosynthesis of secondary metabolites
cit01200  Carbon metabolism
Module
cit_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
cit_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102629129
   00020 Citrate cycle (TCA cycle)
    102629129
   00620 Pyruvate metabolism
    102629129
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    102629129
Enzymes [BR:cit01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     102629129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_ATP AAA_24 AAA_33
Motif
Other DBs
NCBI-GeneID: 102629129
NCBI-ProteinID: XP_006466375
Position
1
AA seq 664 aa AA seqDB search
MAANGNGEFSFGKGTARKGLAKIQTAASQKKQSAICHDDSTPPVKAQTIDELHSLQKKRS
APTTPIKGTPGSFSPVSEEARQKQQLQSISASLASLTRETGPKVVRGDPARKAETPKFAA
DPSDHFSFTPTISVSDSSLKFTHVLYNLSPAELYEQAIKYEQGSFIASSGALATLSGAKT
GRSPRDKRVVKDETTEHELWWGKGSPNIEMDEHTFLVNRERAVDYLNSLDKVFVNDQFLN
WDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMT
SSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALF
FGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKF
GAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFG
VLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLA
EKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEI
PTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILAA
GPNF
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgaacggtaacggagaattcagcttcggaaaaggaacggcgaggaaggggcta
gcgaagattcaaacggcggcttcgcagaagaagcagagcgcgatatgccacgacgacagc
acgccgcctgttaaggctcagacgattgacgagcttcactcgctccaaaagaaaagatct
gcaccaactacccctattaaagggacgccgggctctttttcgcctgtttctgaagaagca
cgacagaaacagcagctccagtccatcagtgcatcgttggcgtcactgacacgagaaaca
gggccaaaggtggtgagaggagatccggcgagaaaggcagagacaccaaagtttgcggca
gatcccagtgaccatttctctttcacgccaacaatcagcgtcagtgacagttccttgaag
ttcacccacgttctctacaatctctctcctgctgaattgtacgagcaggccatcaagtat
gagcaagggtcgtttatcgcgtcaagtggtgcattggcaactctgtctggcgccaagact
ggccgctctcccagagataagcgtgtggtcaaggatgagaccactgagcatgaactttgg
tggggaaagggttcacctaacattgaaatggacgagcacacatttttggtgaacagagaa
agggctgttgattacttgaattctttggacaaagtttttgtgaatgatcaattcttgaac
tgggatccacagaaccgagtcaaagtcagaattgtttctgcaagggcttaccattctttg
ttcatgcacaacatgtgtatccgacccactcctgaagagctggagaattttggtactccg
gacttcactatatacaatgctggacagttcccgtgtaatcgttatactcactacatgaca
tcctccactagcatagaccttaatcttgctaggagggaaatggtcatcctcggcacacag
tacgccggggaaatgaagaagggtcttttcagtgttatgcattatctcatgcctaaacgt
caaatcctctcccttcattctggctgcaatatgggaaaagatggagatgttgccctcttc
tttggattgtcaggtactggaaagacaacactgtctactgatcacaatcgatatctgatt
ggagacgatgaacactgttggggtgacaatggtgtgtcaaacatcgagggtggttgctat
gccaagtgcattgatctctcaagggagaaggagcctgatatctggaatgccatcaagttt
ggcgctgtgttggaaaatgtcgtgtttgatgagcataccagagaggtggattattctgac
aaatctgtcacagagaacactcgtgctgcctaccccattgagtatatccccaatgcaaag
ataccatgcgttggtcctcatcccaagaatgtcatccttttggcatgtgatgcttttggt
gtactcccaccagtgagcaagctgaacctggcacaaacaatgtaccatttcatcagtggc
tacactgctttggtagctggaacagaggatggtattaaggagccaacggcaacattttca
gcttgctttggtgcagcatttatcatgctgcatcctaccaagtatgcagcaatgctggct
gagaagatgcagaagcatggtgctacaggatggctcgtcaacactggatggtcaggtgga
agctatggttgtggcagccgcatcaagttaccgtacactcgaaaaatcattgatgcaata
cactctggcagcctgttgaatgcaaattacaagaaaactgatgtatttggggtggaaatc
cccactgaagtcgagggagtgccttcagaaatcctggatccagagaacacttgggcagac
aagcaggcttacaaggagacactgctgaagctggctggtcttttcaagaggaactttgaa
atattcacaaactacaagattggcaaggacaacaagctcactgaagagatccttgcagct
ggtccaaatttctaa

DBGET integrated database retrieval system