KEGG   Citrus sinensis (Valencia orange): 102629637Help
Entry
102629637         CDS       T02983                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00970  Aminoacyl-tRNA biosynthesis
cit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cit00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    102629637
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cit03029]
    102629637
Enzymes [BR:cit01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     102629637
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     102629637
Mitochondrial biogenesis [BR:cit03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    102629637
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 102629637
NCBI-ProteinID: XP_006492251
Position
Unknown
AA seq 545 aa AA seqDB search
MLSTLHHPPRRLSRFFPANNKPRHFHTKPVLSSSQPVTDQSPSSTSPPESQILSIHHSLL
SREVTATQLAETYLSRLKLAEPQLKSFIHVSNNVLKEAQSIDDKIKRNENVGPLAGVLVG
VKDNICTVDMPSTAGSRVLENYRPPFDATAVKKVKEFDGIVVGKTNLDEFGMGSTTESSS
FQVTANPWDISRVPGGSSGGSAAAVSARQCVVSLGSDTGGSVRQPASFCGVVGLKPTYGR
VSRYGLIAYASSLDVIGCFGSSVADTGILLSAISGHDRLDATSSKQEVPDFTSQLISASL
LESKPLKGLKVGVIRETLENRVDSGVKSTVLGAVSHLEELGCTLSEVSLPSFSLGLPAYY
ILASSESSSNLSRYDGVRYGNQAAAEDLNALYGDSRAKGFGSEVKMRILMGTYALSAGYY
DAYYKRAQQVRTLIQKSFKTALDENDILISPAAPSAAYKIGEKKNDPLAMYSGDIMTVNV
NLAGLPALVLPCGFVEGGPVGLPVGLQMIGAAFDEGKLLKVGHIFEQTLQGCRFVPPLIA
DGIPQ
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcgactctccaccatcctccgcggaggctctctcggttcttcccagccaataat
aaaccccgccattttcacacaaaacccgttctctcttcctcacagcccgtcaccgaccaa
tcgccttcctccacgtcaccgcccgaatcccaaatcctctccatccatcactccctcctc
tcccgcgaggtcaccgccacccagctcgccgaaacctacctatcccgtcttaagctcgcc
gagccccaactcaagtccttcatccacgtctccaacaatgtgctaaaagaagcacaatcc
atcgatgataagatcaagagaaacgaaaacgtggggccccttgctggggttttggttggg
gttaaagataatatatgtacggtggatatgccgtctacggctggctctagagtcttggag
aattatcgtccgcctttcgatgccactgcggttaagaaagtgaaggaatttgatgggatt
gtggtgggtaagaccaatttggatgagtttgggatgggcagcaccactgaatcttcttct
tttcaggtgactgcaaatccttgggatatttctcgggtgccaggaggatcatcgggaggc
tcagctgcagctgtttctgctaggcagtgcgtagtgtctctgggaagtgatactggtgga
agtgttaggcagcctgcgtcattttgtggtgttgtcgggctaaagccgacatacgggcgt
gtctcaagatatggacttatagcgtatgcgtcgtcacttgatgtcataggttgctttggt
tcatcagttgctgatacaggaatacttcttagtgccatttctgggcatgatagacttgat
gccactagtagcaagcaagaggtgcctgatttcacgtctcaacttatttctgcttcactt
ttagaatccaaaccattgaagggactcaaggttggtgtgatccgtgaaactcttgaaaac
agagttgatagtggagtaaaatctacagtccttggagctgtttctcatctggaagaatta
ggatgtactttgtcagaggtatctttaccgtccttctctcttgggttgccagcctactat
attctagcttcatctgaatcttcttccaacttatctcgttatgacggtgtcaggtacggc
aaccaagctgcggctgaggacctaaatgcactctatggagattctagagcaaaaggattt
ggctctgaggtcaaaatgagaattttgatgggaacgtatgccctttcagctggttactat
gatgcatattataagcgtgctcagcaggtgaggaccttaatccagaaaagcttcaagaca
gctttggatgaaaatgatatcctaatttcacctgctgccccatcagccgcatataaaatc
ggtgaaaagaaaaatgatccactggcaatgtattcaggcgatatcatgaccgtaaatgtt
aacttggcaggtctacctgcattggttttgccatgtggattcgtggaagggggacccgtc
ggccttcctgttggtcttcaaatgattggtgcagcatttgatgagggaaaactgctgaaa
gtgggtcatatatttgagcagactcttcaaggttgcagatttgttccgccactcatagcc
gatggcattccacaatga

DBGET integrated database retrieval system